KEGG   Rattus norvegicus (rat): 29187
Entry
29187             CDS       T01003                                 

Gene name
Cd69
Definition
(RefSeq) Cd69 molecule
  KO
K06502  CD69 antigen
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    29187 (Cd69)
   04091 Lectins [BR:rno04091]
    29187 (Cd69)
CD molecules [BR:rno04090]
 Proteins
  29187 (Cd69)
Lectins [BR:rno04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   29187 (Cd69)
SSDB
Motif
Pfam: Lectin_C LRR19-TM Chordopox_A33R
Other DBs
NCBI-GeneID: 29187
NCBI-ProteinID: NP_599154
RGD: 61318
Ensembl: ENSRNOG00000056783
UniProt: Q5M851
Position
4q42
AA seq 199 aa
MNSEECSITENSSSHLERGQRDHGTSVHFEKHREGSIQVPIPCAVLVVVLITSLIIALFA
LSVGKYNCPGFYENLESFDHHAASCKNEWFSYNGKCYFFSTTTKTWALAQKSCSEDDATL
AVIDSEKDMAFLKRYAGGLKHWIGLRNEASQTWKWANGKEFNSWFNVTGSKKCVSLNHTD
VASVDCEANLHWICSKASL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaattctgaagagtgttccataacagaaaatagctcttcacatctggagagagggcag
agggaccatggcaccagtgtacattttgagaagcatcgtgaaggatccattcaagttcct
atcccttgtgctgtgctcgtagtggtcctcatcacttccttaattatcgctctctttgcc
ttaagtgtgggcaagtacaattgtccgggcttctatgagaatctggagtcatttgaccac
catgctgcttcctgcaagaatgagtggttttcatacaacgggaaatgttactttttctcc
accacaaccaagacttgggccttggcccaaaaatcttgttctgaagatgacgctaccctt
gctgttattgattcggaaaaggacatggcgtttctgaagcgatatgctggtggactgaaa
cactggattgggctgagaaacgaagctagtcagacatggaaatgggcaaatggcaaagaa
tttaacagctggttcaacgtgacagggtctaaaaagtgcgtgtctctgaaccacacagat
gttgcttctgtagactgcgaggcaaacttacactggatctgcagcaaggcctccctatga

DBGET integrated database retrieval system