KEGG   Rattus norvegicus (rat): 292022
Entry
292022            CDS       T01003                                 

Gene name
Ddx19a
Definition
(RefSeq) ATP-dependent RNA helicase DDX19A
  KO
K18655  ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    292022 (Ddx19a)
   03015 mRNA surveillance pathway
    292022 (Ddx19a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    292022 (Ddx19a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     292022 (Ddx19a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     292022 (Ddx19a)
SSDB
Motif
Pfam: DEAD Helicase_C
Other DBs
NCBI-GeneID: 292022
NCBI-ProteinID: NP_001005381
RGD: 1303136
Ensembl: ENSRNOG00000018033
UniProt: Q68FX3
Position
19
AA seq 478 aa
MATDSWALAVDEQEAAVKSMNSLQIKEEKVKADTNGVIKTSTTAEKTEEEEKEDRAAQSL
LNKLIRSNLVDNTNQVEVLQRDPSSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQEN
ALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPADRHPQCLCLSPTYELALQTGKV
IEQMGKFHPELKLAYAVRGNKLERGQKVGEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVL
DEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNIIKLKREE
ETLDTIKQYYVLCNNREEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVA
LLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNE
TYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggccaccgactcctgggcgctggcggtggacgagcaggaagccgctgtcaagtcgatg
aacagtttgcagatcaaggaagagaaagtcaaagcagacaccaatggtgttatcaaaacc
agcaccactgcagaaaagacagaggaagaagagaaagaggacagagctgctcagtcttta
ctcaacaagctgatcagaagcaatcttgtggataacaccaaccaagtggaagtcctgcag
agggacccgagctccccgctctactcagtgaagtccttcgaggagcttcgcctgaaacca
cagcttctccaaggagtctatgccatgggcttcaatcgaccatccaagatccaggagaat
gctttgcccatgatgcttgctgaacccccacagaacctgattgcacagtcccagtctggt
actgggaaaacagctgcctttgtcttagctatgctcagcagagtggaaccagcagacaga
caccctcagtgtttgtgcctgtccccaacatacgagctggcactgcaaacaggaaaagtg
attgagcagatgggcaaatttcatccagaattgaagctagcttatgctgttcgaggcaat
aaattggaaagaggtcagaaggtcggtgagcagattgtcatcggtacccctgggaccgtc
ctggactggtgctccaaactgaagttcattgaccccaagaagatcaaggtgtttgttctg
gacgaggctgatgtgatgatagcgactcagggccaccaagaccagagcatccgcatccag
aggatgctgcccagaaactgccagatgctgcttttctctgccacctttgaagactcagtg
tggaagtttgcccagaaggtggtcccagaccccaacatcatcaagctgaagcgtgaagag
gagacgttggataccatcaaacagtattatgtcctttgcaataacagagaggagaagttc
caggccctgtgcaacttgtacggggccatcaccatcgcccaagccatgatcttctgccat
acccgcaaaacagctagctggctggcggcagagctctccaaagagggccaccaggtggcc
ctgctgagtggagagatgatggtggagcagagggctgctgtgatcgagcgcttcagagaa
ggcaaagagaaggttctggtgaccaccaacgtgtgtgcccgtggtattgatgttgaacaa
gtgtctgtggtcatcaattttgaccttcctgtggacaaggacgggaacccagacaatgag
acctacctgcaccgcattgggcgcacaggccgctttggcaagaggggcctggcagtaaac
atggttgacagcaagcacagcatgaatatcctcaacagaatccaggagcatttcaataag
aagatagaaagattggacacagatgacttggacgagatcgagaaaatagccaactga

KEGG   Rattus norvegicus (rat): 690693
Entry
690693            CDS       T01003                                 

Gene name
Ddx19b
Definition
(RefSeq) ATP-dependent RNA helicase DDX19B
  KO
K18655  ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    690693 (Ddx19b)
   03015 mRNA surveillance pathway
    690693 (Ddx19b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    690693 (Ddx19b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     690693 (Ddx19b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     690693 (Ddx19b)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 690693
NCBI-ProteinID: NP_001005895
RGD: 1593382
Ensembl: ENSRNOG00000018033
UniProt: A0A0G2K7X6 Q5XLP8
Position
19
AA seq 479 aa
MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDANGAVVKTSANTEKTEEDEKEDRAAQS
LLNKLIRSNLVDNTNQVEVLQRDPSSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQE
NALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANNHPQCLCLSPTYELALQTGK
VIEQMGKFYPELKLAYAVRGNKLERGQKVGEQIVIGTPGTVLDWCSKMKFIDPKKIKVFV
LDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNIIKLKRE
EETLDTIKQYYVLCNNREEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQV
ALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDN
ETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggccacggattcttgggccctagcagtggacgagcaggaagccgccgctgagtcgttg
agcaacttgcatcttaaagaggagaaaatcaaaccagatgccaatggtgctgttgttaag
accagtgctaacacagagaagacagaggaagatgagaaagaggacagagctgctcagtct
ttactcaacaagctgatcagaagcaatcttgtggataacaccaaccaagtggaagtcctg
cagagggacccgagctccccgctctactcagtgaagtccttcgaggagcttcgcctgaaa
ccacagcttctccagggagtctatgccatgggtttcaaccgcccttccaagatccaggag
aatgcactgcctttgatgcttgctgagcccccacagaacttaattgcccagtctcagtct
ggtactgggaaaacagctgccttcgtgttggccatgctcagccaagtagagcctgcaaac
aaccatccccagtgtctctgcctctctccaacctatgagctggctcttcaaacaggaaaa
gtgattgagcagatgggcaagttttaccctgaactgaagttagcttatgctgttcgaggc
aataaattggaaagaggtcagaaggtcggtgagcagattgtcatcggtacccctgggacc
gtcctggactggtgctccaaaatgaagttcattgaccccaagaagatcaaggtgtttgtt
ctggacgaggctgatgtgatgatagcgactcagggccaccaagaccagagcatccgcatc
cagaggatgctgcccagaaactgccagatgctgcttttctctgccacctttgaagactca
gtgtggaagtttgcccagaaggtggtcccagaccccaacatcatcaagctgaagcgtgaa
gaggagacgttggacaccatcaaacagtattatgtcctttgcaataacagagaggagaag
ttccaggccctgtgcaacttgtacggggccatcaccatcgcccaagccatgatcttctgc
catacccgcaaaacagctagctggctggcggcagagctctccaaagagggccaccaggtg
gccctgctgagtggagagatgatggtggagcagagggctgctgtgatcgagcgcttcaga
gaaggcaaagagaaggttctggtgaccaccaacgtgtgtgcccgtggtattgatgttgaa
caagtgtctgtggtcatcaattttgaccttcctgtggacaaggacgggaacccagacaat
gagacctacctgcaccgcattgggcgcacaggccgctttggcaagaggggcctggcagta
aacatggttgacagcaagcacagcatgaatatcctcaacagaatccaggagcatttcaat
aagaagatagaaagattggacacagatgacttggacgagatcgagaaaatagccaactga

DBGET integrated database retrieval system