KEGG   Rattus norvegicus (rat): 29210
Entry
29210             CDS       T01003                                 

Gene name
Epha3
Definition
(RefSeq) ephrin type-A receptor 3 precursor
  KO
K05104  Eph receptor A3 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    29210 (Epha3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29210 (Epha3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     29210 (Epha3)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   29210 (Epha3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_2 SAM_1 Pur_ac_phosph_N Ephrin_rec_like fn3_2 ABC1 Interfer-bind Kdo Haspin_kinase Pkinase_fungal SusE
Other DBs
NCBI-GeneID: 29210
NCBI-ProteinID: NP_113752
RGD: 68389
Ensembl: ENSRNOG00000030285
UniProt: O08680
Position
11
AA seq 984 aa
MDCHLSILILLGCCVLSCSRELSPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFLEHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCTCNAGYEERGFICQACRPGFYKALDGVAKCTKCPPHSSTQEDG
SMNCRCENNYFRAEKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDITFN
IICKKCGWNVRQCEPCSPNVRFLPRQLGLTNTTVTVTDLLAHTNYTFEIDAINGVSELSS
PPRQFAAVSITTNQAAPSPVMTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGENS
HVVMIAISAAVAIIVLTVVTYVLVGRFCGYHKSKHSSDEKRLHFGNGHLRLPGLRTYVDP
HTYEDPTQAVHEFAKELDATNIAIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGY
TEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAY
TTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDE
GYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS
NLLLDQSNVDIATFHTTGDWLNGMRTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVV
GPQKKIISSIKALETQSKNGPVPV
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggattgtcacctctccatcctcatcctgctcggctgctgcgtcctcagctgctccagg
gaactgagtccacagccttccaacgaagttaatctactagattcaaaaacgattcaagga
gagctgggctggatctcctacccatcccacgggtgggaagagatcagtggtgttgatgag
cattacacaccaatcaggacttaccaggtatgcaatgtcatggatcacagccaaaataat
tggctgaggacaaactgggtgccgagaaactcagctcagaagatctatgtggagctaaag
ttcacactgcgggactgtaacagcattccattggttttggggacgtgcaaggagaccttt
aacctgtactacatggagtctgatgatgatcacggtgtcaaattcctagagcatcagttt
acaaagattgacaccatcgccgctgatgaaagtttcactcaaatggatctcggggaccgc
attctaaaactcaacactgagattagagaagtgggaccagtcaataaaaaggggttttat
ttggcctttcaagatgttggtgcttgtgttgccttggtgtctgtgagagtgtacttcaaa
aagtgcccatttacagtgaagaatctggctatgtttccagacacagtgcccatggactcc
cagtccttggtggaggttaggggctcttgtgtcaataattccaaggaggaggaccctccc
aggatgtactgcagtacagaaggtgaatggctggtccccattggcaagtgcacttgcaat
gctgggtatgaagaacgagggttcatatgccaagcttgtcggccaggcttctacaaggct
ttggatggtgttgccaagtgtactaagtgcccaccacacagctcaacccaagaagatggt
tcaatgaactgcaggtgtgagaataattatttccgggcagaaaaagaccctccatccatg
gcttgtacccgacctccatccgcaccaagaaatgttatctctaacataaatgagacctcg
gttatcctggactggagctggcccctggacacaggaggccggaaggatattaccttcaac
atcatatgtaaaaaatgtgggtggaatgtcaggcagtgcgagccatgcagccccaacgtc
cgcttcctccctcgtcagcttggactcaccaacaccacggtgacagtgacagacctcctg
gcacatactaactacacctttgagattgatgccattaatggagtgtcagagctgagctcg
ccaccgagacagtttgccgccgtcagcatcacaactaatcaggctgctccatcaccagtt
atgacaattaagaaagatcggacttccagaaacagtatctctttatcttggcaagaacca
gaacatccaaatggaattatacttgactacgaggtcaaatactatgaaaagcaggagcaa
gagacgagttataccattttgagggcaagaggcacaaatgttactatcagtagcctcaag
ccagatactacttacgtattccaaatccgagctcgaacagcagcaggatacggaaccaac
agccgcaaatttgaatttgaaactagtccagactccttctccatctctggtgaaaacagt
catgtggtgatgatcgcgatttcagctgctgtggccatcattgtcctcactgttgtcacc
tacgttttggtcgggagattttgtggctatcacaagtcaaaacacagttcagatgagaag
cgccttcactttgggaatgggcacttaagacttccaggtctcaggacatatgttgatcca
catacatatgaagaccctacacaagcagttcatgagtttgcgaaagaattggatgccacc
aacatagccatcgacaaagttgttggagcaggtgaatttggagaagtttgcagtggtcgc
ttaaaacttccttcaaaaaaagagatttcagtggctatcaagaccctgaaagtgggctac
acggagaagcagaggagagactttctaggagaagcaagcatcatgggacagtttgaccac
cccaacatcatccgactggaaggagttgtcactaaaagtaagccagtgatgattgtcaca
gaatacatggagaatggttccctggacagtttcttacgtaaacatgatgcccagtttaca
gtcatccagctcgtgggaatgctccgtgggatagcatctggtatgaagtacctctcagat
atgggctatgtccaccgcgaccttgctgctcggaacatcttgatcaacagtaacttggtg
tgcaaagtctctgacttcggactttctcgagtgttggaagatgaccctgaagctgcttac
accaccagaggaggaaagataccaataaggtggacatcaccagaagcaattgcctaccgc
aagttcacatcagccagcgatgtatggagttacgggattgtactctgggaagtgatgtct
tacggagaaaggccgtattgggagatgtccaatcaggatgtaattaaggccgtggatgag
ggctatcgcctgccacctcccatggactgcccagctgccctgtatcagttgatgttggac
tgctggcagaaagacaggaacaacagacccaagtttgagcagatcgtcagcattctggac
aagctcatccggaatccaggcagtctgaagatcatcactagcgcggctgcaaggccatca
aaccttcttctggaccaaagcaatgtcgatattgctacgttccacacaacaggtgattgg
cttaacggtatgaggacagcacactgtaaggaaatcttcacgggtgtggagtacagctcc
tgtgacaccattgccaagatctccacagatgacatgaaaaaggttggtgttactgtggtt
gggccacagaagaagatcatcagttccattaaagctctagaaacacaatctaagaatggt
ccagttcccgtgtaa

DBGET integrated database retrieval system