KEGG   Rattus norvegicus (rat): 29254Help
Entry
29254             CDS       T01003                                 

Gene name
Mgll, MAGL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04923  Regulation of lipolysis in adipocytes
Module
rno_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    29254 (Mgll)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    29254 (Mgll)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    29254 (Mgll)
  09159 Environmental adaptation
   04714 Thermogenesis
    29254 (Mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    29254 (Mgll)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     29254 (Mgll)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S33
   29254 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 LIDHydrolase Abhydrolase_5 Thioesterase PGAP1 Abhydrolase_3 Peptidase_S9 Abhydrolase_2 Ser_hydrolase DUF1350 DUF2974 PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 29254
NCBI-ProteinID: NP_612511
RGD: 71039
Ensembl: ENSRNOG00000014508
UniProt: Q8R431
Position
4q34
AA seq 303 aa AA seqDB search
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVNTVQKDYPEVPVFLLG
HSMGGAISILAAAERPTHFSGMILISPLILANPESASTLKVLAAKLLNFVLPNISLGRID
SSVLSRNKSEVDLYNSDPLICHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSPSQDKTLKMYEGAYHVLHKELPEVTNSVLHEINTWVSHRIAVAGAR
CLP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggcaagttcacccaggcgaactccacagaacgtcccctaccaggaccttcct
cacctggtcaatgcggatggacagtacctcttttgtaggtactggaagcccagtggcaca
cccaaggccctcatcttcgtgtcccatggagctggggaacactgtggccgttatgacgag
ctggctcagatgttgaagaggctggacatgctggtgtttgcccatgaccatgttggccat
gggcagagcgagggagagaggatggtggtatcggacttccaagtttttgtcagagatttg
ttgcagcacgtgaacaccgtccagaaggactaccccgaggtccccgtcttcctcctgggc
cactccatgggcggtgccatctccatcctagcagctgcagagagaccaacccacttttct
ggcatgatcctaatttcacctctgatccttgccaatccggaatctgcatcgactttgaag
gtccttgctgccaaactgctcaattttgtcctgccaaacatatccttggggcgcatcgac
tccagcgtgctgtctcggaacaagtcggaggttgacctgtacaactccgacccactcatc
tgccacgcaggggtgaaggtatgctttggcatccagctgctgaacgctgtctcgagggtg
gagcgagcaatgcccaggctgacactgccgttcctgctgctgcagggttctgctgaccgg
ctttgcgacagcaaaggtgcctacctgctcatggaatcatccccgagtcaggacaaaaca
ctcaagatgtatgaaggtgcctaccatgttctccacaaggagcttccggaagtgaccaac
tctgtcctccatgaaataaatacgtgggtgtctcacaggatagcagtggcaggagctagg
tgtctaccctga

DBGET integrated database retrieval system