KEGG   Rattus norvegicus (rat): 292545
Entry
292545            CDS       T01003                                 

Gene name
Nlrp4a, RGD1561918
Definition
(RefSeq) NLR family, pyrin domain containing 4A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_30 PIN_12 AAA_14
Other DBs
NCBI-GeneID: 292545
NCBI-ProteinID: NP_001099690
RGD: 1561918
Ensembl: ENSRNOG00000042030
UniProt: D3ZUH1
Position
1q12
AA seq 982 aa
MASFFSDFGLMWYLEELNKKEFMKFKEFLKQEILQLGLKQVSWTEVKKASREDLASLLLK
HYEEKQAWDMTFNFFQKINRKDLIKRAKREIDGYPKLYRAHLKTKLTHDSSRIFNINIQD
FLKEKFTKDDHDRFETLLQSKGTESKPQVVVLSGVAGIGKTLMLKRLMLAWIEGLVFPYK
FSYIFYFCCQEVKQLKTASLAELISREWPDPSAPIEEILSEPEKLLFIIDSLEGIECDLF
KCDSELCDNCMEKQPVNILLSSLLRKKMLLEASLLISTTPETFEKMEDRIEYTHVKIITG
LNESDIKMCFHRLFQDRNRAQEAFSLVRENEQMLTICQVPVLCWMVATCLKTEIEKGRNL
VSTCRRTTSLYTTYIFNLFIPQSAHSPSKKSQDQLQGLCSLAAEGIWTDTFVFTEEALRR
NGILDSDIPTLLDIGMLGKMGKFENCYIFLHPSLQEACAAIFYLLKSHGDHPIEDVKSVE
ALLFTFLKKAKVQWILGGRFIFGLLHESEQKKLEAFFGHQLSQEIKHQLYQCLETISVNE
ELQEQIDGMKLFYCLFEMEDEDFLMEAMNYMEQINFVAKDYSDVIVAAYCLKHCYTLKKL
SFSTQNILNEEHEHSCMENLLTCWRHICSVLINSKDIQELQIKDTNLNEPAFSVLYNSLK
YCNDTLKVLVENNVFFLCEKYLFFELIQNCNLQHLNLNLTFLSHSDVKLLCDVLNQAECN
IEKLEVAACNLSPDDCKMFASILMSSKTLKQLNLSSNILGKGISSLCKSLCHPDCILEHL
VLAKCSLSDQCWDYLSDGIRQNKTLNHLDISSNDLKDEGLKVLCRALALPNSVLKSLCLR
HCLITTSGCQDLAEVLRNNQNLTSLQISYNKIEDAGVKLLCDAIKQPNCHLEDLGLEACE
LTGACCEDLASTFTQCRTLWGINLLNNTLDYTGLVVLCEALRQQKCTPHVLGLRITDFDN
ETQAFLVAEQEKNPDLSILSGV
NT seq 2949 nt   +upstreamnt  +downstreamnt
atggcatctttcttttctgattttggccttatgtggtacttggaagagttaaacaagaaa
gaattcatgaagtttaaggagttcctcaaacaggagattttgcaactagggctgaagcag
gtttcctggacagaagtgaagaaagcatcccgggaagaccttgccagcttactgttgaaa
cattatgaagaaaagcaagcctgggatatgaccttcaattttttccagaagatcaatagg
aaggatctcataaagagggcaaaaagagagattgacggatacccaaaattataccgagct
catctgaagacaaagctgacccatgacagttccagaatatttaatattaatattcaggat
tttttgaaggagaaatttaccaaggatgaccatgatcgttttgagacccttcttcaatca
aagggaactgaatcgaagccacaggtggtggtcctgagtggtgttgctggaattggcaag
acactgatgttgaagaggttaatgctggcctggatagaaggcctcgtgtttccatacaaa
ttctcctacatcttctacttctgctgtcaagaagtgaagcagttgaagacagctagcctg
gctgaactgatctccagagaatggcctgacccctcagctcccatagaggagattctatct
gaacctgaaaaactcttatttatcattgacagcttagaagggatcgaatgtgatttgttc
aaatgtgattcagagctgtgtgataactgcatggagaagcagccagtgaatatactgtta
agcagtttgctcagaaagaagatgctcttagaagcctctctcctcatttccactacccca
gaaacttttgaaaagatggaggacaggattgagtacacacatgtgaaaataataacagga
cttaatgagagcgatattaagatgtgtttccacagattattccaagataggaacagagcc
caggaagccttcagtctggtgagagaaaatgagcagatgttgactatatgtcaagtccct
gtgctctgctggatggtggctacttgtctaaaaacagaaatagagaagggaagaaatcta
gtctccacctgccgacggaccacctctctgtacactacttatatcttcaatttgttcatt
ccccaaagtgcccattctccaagtaagaaaagccaagaccagctgcagggcttgtgttct
ctagctgcagagggcatatggactgacacatttgtttttactgaggaggctctcaggaga
aatgggatcctggattctgacatccccacactattggacattggcatgcttggaaagatg
ggaaaatttgaaaattgttacattttcctccacccatctctccaggaggcctgtgctgcc
atcttttatctgctaaagagccatggagaccaccctatcgaggacgtaaaaagtgtagag
gcactcttgtttacatttctaaagaaagccaaagtacagtggattttggggggccgtttc
atctttggccttttacatgaatcagaacaaaaaaagctagaggcattttttggccaccag
ttgtcccaggaaataaaacatcagctgtatcagtgcctggaaaccataagtgtcaatgaa
gagcttcaagaacagatagatggcatgaagttgttttactgtctgtttgagatggaggat
gaagactttttaatggaagcaatgaactatatggaacagattaactttgtggctaaggat
tattctgatgttattgttgctgcctactgcttaaaacactgttatacactgaagaaacta
tccttttctacccaaaatattcttaatgaagaacacgaacacagctgtatggaaaatctt
ctaacctgttggcgtcatatttgctctgtgctcataaacagtaaggacatccaggaactc
caaataaaagacactaatctcaatgaaccagcattctcagtcttgtataatagtttgaag
tactgcaatgacacccttaaagtacttgtggaaaataatgtgttcttcttatgtgaaaag
tacctgttctttgagttgattcagaattgcaatttacagcacttgaacctcaacctcaca
ttcctctcccacagtgatgtgaaactgttgtgtgatgtcttgaaccaggcagaatgcaac
atagaaaaactggaggtagcagcctgtaacctttcacctgatgactgcaagatgtttgcc
tctatcctgatgagcagcaagactttaaagcaacttaatttgtcatccaatatcttagga
aaagggatatcctcactgtgcaaatctttgtgccacccagactgcattctggagcactta
gttttggccaagtgttccctcagtgaccaatgttgggactacctttctgatggtattagg
cagaacaaaactctgaaccatcttgatatcagctccaatgatctgaaggatgaaggactg
aaggttctctgtagggctctggctctcccaaacagtgtcctcaagtcactatgtttgaga
cattgtctcatcaccactagtggctgccaggacctggctgaagtcttaaggaacaaccag
aacctgaccagtctacaaatttcatacaataagatagaagatgctggtgtgaagctgctg
tgtgatgctataaaacaacccaactgccacttagaggatcttgggttggaagcctgtgag
ctaactggtgcctgttgtgaggaccttgcttctacatttacccagtgtaggactctgtgg
gggatcaacctgctaaataacaccttggactacactggcttggttgtcctgtgtgaggct
ttgagacagcaaaagtgtaccccgcatgtacttggattgcgaattactgattttgataat
gaaacccaggcatttctggttgctgagcaagagaaaaatcctgacttgagcatcctaagt
ggcgtgtga

DBGET integrated database retrieval system