KEGG   Rattus norvegicus (rat): 292610
Entry
292610            CDS       T01003                                 

Gene name
Zfp606
Definition
(RefSeq) zinc finger protein 606 isoform X2
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    292610 (Zfp606)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    292610 (Zfp606)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    292610 (Zfp606)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz zf_C2H2_13 zinc_ribbon_15 HalOD2 C1_4
Other DBs
NCBI-GeneID: 292610
NCBI-ProteinID: XP_006228201
RGD: 1309810
Ensembl: ENSRNOG00000019127
Position
1
AA seq 774 aa
MDQSDPSVSWALCPQDPAWHIEGSPEESRRQADGLQTAQDQEPVTFKDVAVAFTQEEWEQ
LDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQEEPWSLEQGYPKSSCPEWMRNV
ESKALIPAQSVFEEEQSSNGMVLERYIWDNPWLSRLGVLGYGDQIEMYHMNQNAGMREMV
FMQKQVLSQRGSEFCKLGTEYSQSLNLIPPQRVSQLEHFYKSDTHLETWRCNSAIMYADK
VTCENIDYEKAFCQSVQPVYPAKLQTRDNMFKCTDAVKSFNHIIQFGDHKAVHTGEKLYG
YKEYHQIFNQSPSLIEHPRFQIGGNQYEKYKEYGNIFYFSSFMEHQNIGGVEKAYKYNEW
EKVFGYDSLLAQHTSTYTAEKPYEFNKCGTSFIWSSYLIQHKKTHPGDKPYECDKCRKVF
RNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHTRIHTGEKPYVCNECGKSFNWNS
HLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFKCDECEKAFRDYSALSK
HERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQECGKAFRERSALTKHEII
HSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKSFSQSCHLVAHRRIHTGE
KPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNESSSLIVHLRNHTGEKPYK
CIHCEKAFCKNSSLIIHQRMHSGEKRFICNQCGRAFSGHSALLQHQKNHSEEKL
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggaccagtctgacccttctgtctcctgggctctatgccctcaggatccagcatggcac
atagagggaagccctgaggagagcagaagacaggcagatgggcttcaaacagcccaagac
caggaaccagtgactttcaaagatgtggctgtggcctttacccaagaagaatgggagcag
ctagaccttgttcagcggactctgtaccgtgatgtgatgctagagacttatggacaccta
ctttctgtggggaatcagattgctaagcctgaagtcatctcccttttggaacaagaagag
ccatggtcactggagcaaggatatcctaagagcagctgtccagagtggatgagaaatgtt
gaaagcaaagcattgattccagcacagagtgtttttgaggaagaacaatccagcaatgga
atggtgttagaaagatacatatgggataatccatggctctccaggttaggagttttggga
tatggagaccaaatagaaatgtatcacatgaatcagaacgcaggtatgagggaaatggtc
ttcatgcaaaaacaagtactttctcaacgaggttctgaattctgtaaacttggcacagag
tacagccaaagcttaaacttaattccacctcaaagagtttctcaattagaacatttctac
aaatctgatacacatcttgaaacttggagatgtaattcagccataatgtatgcagacaaa
gttacctgtgaaaatattgattatgaaaaagccttctgccagtctgttcagcctgtttac
cctgcaaaattgcaaactagagataatatgttcaaatgtactgatgctgtgaagtctttc
aatcatattatacagtttggtgatcataaagcagtacatacaggagaaaaactctatgga
tataaggaataccatcaaatctttaaccagagcccatcacttattgaacatccaagattt
caaattggaggaaaccagtatgagaaatataaagagtacgggaatatcttttatttctca
tcttttatggaacatcaaaacattggtggtgtagaaaaggcatataaatataatgaatgg
gagaaagtctttggttatgactcattacttgctcaacatacaagcacatacactgcagag
aaaccctatgaattcaacaaatgtggtacatcttttatctggagctcttaccttattcaa
cataagaaaactcatcctggagataaaccctatgaatgtgataaatgcagaaaagttttt
aggaatcgttcagcccttactaagcatgaacggactcacactggaataaaaccttatgaa
tgtaacaaatgtgggaaagccttcagttggaattctcatcttattgtacacacaagaatc
catacaggagaaaaaccttatgtatgtaatgaatgtgggaaatcattcaactggaattcc
catcttattgggcatcagagaactcatactggagagaaaccttttgagtgtactgaatgt
ggcaagtcttttagctggagttcccatcttattgcccatatgcggatgcatactggagag
aaaccctttaaatgtgatgaatgtgaaaaggcttttagagattattcagcccttagtaaa
catgaaagaactcactctggagcaaaaccatataaatgtactgagtgtggaaagtccttc
agctggagctcccatcttattgctcaccaaagaactcacacgggagagaaaccttacaac
tgtcaagaatgtggcaaagctttcagagagcgttcagcccttacaaaacatgaaattatt
cattctggaattaagccctatgaatgtaataaatgtggaaaatcatgtagccaaatggcc
catcttgttaggcatcaaaggactcatactggagaaaagccctatgaatgcaataaatgt
ggaaaatccttcagtcagagctgtcaccttgttgctcatcggagaattcacactggtgag
aaaccctataaatgtaatcaatgtgaacgatcctttaattgtagctctcacctaattgca
caccggagaactcatactggagaaaaaccatacaggtgcaatgagtgtgggaaggcattt
aatgagagttcttccctgattgtacacttgagaaaccatactggagagaaaccctacaaa
tgtattcattgtgaaaaagctttctgtaagaattcttccctgattattcatcagagaatg
catagtggagagaaacgctttatatgcaatcaatgtggaagagcctttagtggtcattca
gccttacttcaacatcagaaaaatcatagtgaagagaaactgtaa

DBGET integrated database retrieval system