KEGG   Rattus norvegicus (rat): 292750
Entry
292750            CDS       T01003                                 

Gene name
Plekhg2, RGD1310112
Definition
(RefSeq) pleckstrin homology and RhoGEF domain containing G2
  KO
K23859  pleckstrin homology domain-containing family G member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    292750 (Plekhg2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   292750 (Plekhg2)
SSDB
Motif
Pfam: RhoGEF PH
Other DBs
NCBI-GeneID: 292750
NCBI-ProteinID: NP_001128444
RGD: 1310112
Ensembl: ENSRNOG00000030266
UniProt: G3V9A0
Position
1q21
AA seq 1344 aa
MPEGARGLSLSKPSLRLGCGHQGEVCDCAAVSDTPTAPAAPNMASPRGSGSSTSLSTVGS
EGDPSPACSASKPEPLPEPPIRLHLSPVGIQGSVKLSMLERVAREIVETERAYVRDLRSI
VEDYLGPLMDGRALGLNVEQVGTLFANIEDIYEFSSELLEDLEGCSSAGGIAECFVQRSE
DFDIYTLYCMNYPSSLALLRELSLSPPATVWLQERQAQLRHSLPLQSFLLKPVQRILKYH
LLLQELGKHWAEGPDTGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRRLGGWT
GPELSAFGELVLEGTFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGPEYTYKGHIFCCN
LSVSETPRDPLGFKVSDLTIPKHRHLFQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQ
VLLENSLHCAPKSKHIPEPPTSPLDSPRPRDARSFTPSRRNPAPSPRLSGSRRGRRQSES
KDPYVILPQNDKPQVKHAGSEGELHPPSELQPPVTAPGPPEDLEDAGPPTLDPSGTSITE
EILELLNQRGLRDSGPATHDIPKFPRDSRVPVESETLPFQALPSRESSEEEEDEELEKDE
REPSPLHVLEGLEGSSAAEVPCIPSLPKIPSDMPDLPEIPEAPCLPSLSDIPGVFEVPCL
SPMSSVPDIPSLANTPSFPCGSWLPGPLQEAAQSQATRRELLTGSNLGRLSEPPSESRAG
QEEDTEGVSFPAVQTQDGTPVQGFPEELEYRSCSEIRSAWQALEQGQLARPGFPEPLLIL
EDSDLSGGSTSGKTRMPHSERSASRVRELARLYSERIQQMQRAETRASTNAPRRRPRVLA
QPQPCPCPPQEEAEPGALPAFGHVLVCELAFPLNCAQESVPLGPAALVQAATPLCTQGDD
LSGQSLTVSDLPKQGHLSNNCIPPPVPLPGQSNFQSLQVPSASLLPKQDPPDVQLPTAST
LPDTGQLQVPAAAPSTEHRNYVEIQVQSTTTSLPGQECPADFQMPTTAALPRQEGHEDSR
SPNSAPGAEQRDVGVDQGPTAVDGQAVSPLPACTSSPDHHQIPATPLPLSPDLPDMEGAG
ALPLPAQQGHPDCCVPCDPLPSLPQDVQTPTVIPMSQPQGLTDVRAKVPPSFPTQEEAPE
FLGPEPSLTDTPAPRLLPSSGQQNTTDGHVSTAAVPCPEQGCPQDIQGLITSPVQTTMEL
PKPRGLVSRVATSESLDLTPPHSPSLSTRQLLGPSAAALSRYLAASYISQSLARRQGPGG
EGMAASQGHWSSSAPTSRAPSPPPQPQPPAPPARRLSYATTVSIQVGGGGRLRPARAQVR
LNHPALLAAPHPGAFGPSQGPEGS
NT seq 4035 nt   +upstreamnt  +downstreamnt
atgccagagggagcccggggactcagcctgtccaaacccagccttaggctcgggtgtggt
caccaaggtgaagtttgcgactgcgcagctgtgagtgatactccaacagctcccgcagcc
cccaacatggcttctccaaggggctctggcagctccacctctttgagcaccgtgggctct
gagggggacccatctccagcttgctcagcctccaagccagagcccctgccagagcccccc
atacgcctgcacctgtcgccagtggggatccaggggtcagtgaaactgtccatgctggaa
cgagtggccagggagattgtggagacagagcgggcatatgtccgggaccttcgcagcatc
gtggaggattacctgggccctctgatggatggcagggccctagggctgaacgtggagcag
gtgggcactctgtttgcaaacatcgaggacatctatgagtttagcagtgagctcctggag
gacttggagggctgcagcagtgcagggggcatcgccgagtgcttcgtgcaaaggagcgaa
gattttgacatctacacattgtactgcatgaactacccgagctccctggccctgctccga
gagctgtcactgtccccgccagccactgtgtggctgcaggagcgtcaggcccagctccgt
cactccctgcctctgcagagcttcttgctgaagcctgttcagcgcatcctgaagtaccat
ctcctgctgcaggaactgggcaagcactgggcagaaggcccagacaccggagggcgagag
atggtggaggaagccatcgtgtccatgaccgcagtggcctggtacatcaatgatatgaag
cgcaagcaagagcacgcagcacgcctgcaggaagtgcagcggcggctgggtggctggact
ggcccggagctcagtgcctttggagagctggtcctggaaggcaccttccgtgggggaggc
gggggaggcccaaggcttcgtgggggcgagcgcctgctcttcctgttctcccgaatgctg
ctggtagccaagcgtcgggggcctgaatacacctacaagggtcacatcttttgttgtaac
ctgagtgtaagcgagactcctcgagatcccctaggatttaaggtgtcagacctgaccatc
cccaagcacagacacctgtttcaggccaagaaccaagaagagaagcggttgtggatccac
tgtctccagcgcctcttcttcgagaaccacccggcttccatccctgccaaggcaaagcaa
gttctcttggaaaacagcctgcactgtgccccaaaaagcaaacacatcccagaaccccca
acatcccctctggactctccccgacctcgagatgctcgaagttttacccccagcagaagg
aacccagctccatctccaagactttctggcagtcgccgtggccgcaggcagtctgagtca
aaggacccttatgtcatccttccccagaacgataagcctcaagtcaagcatgctggcagt
gaaggtgaactccatcccccatctgagttgcagccaccagtaactgctcctggtccccct
gaagacctggaggatgctgggccccccacattggacccatcggggacgtccataactgag
gaaattctagaactgctgaaccagagaggcctcagggactcggggccagccacccacgac
attcccaagttccccagagactccagggtgcccgttgaaagtgaaaccctcccgttccaa
gctctgcccagccgagagtcttcagaagaggaggaggatgaagagctggagaaagatgaa
cgggagccttccccgctccatgtcttagaggggctggaaggttccagtgcagctgaagtt
ccctgcattcccagccttcctaagattcccagtgacatgcccgaccttccagaaattccc
gaggctccctgccttccaagtctctctgatatccctggtgtttttgaggtgccctgtctt
tcacccatgtccagtgtgcctgacattcccagcttggccaacaccccgtccttcccctgt
ggctcctggctccctggacccctgcaggaggcagcccagtctcaagccaccaggagggaa
ctgttgactgggagcaacctgggaagactgagtgagccaccctcagaaagcagagccggg
caggaggaagacacagaaggcgtgtccttcccagctgtgcagacccaggatggcacccca
gtccaaggattcccggaagaactggaataccgctcctgttcagaaatccggagtgcctgg
caagcactggagcaggggcagctggcccggcctggcttcccagaacctctgctgatcctg
gaggactctgatcttagtggaggcagcaccagtgggaagacaagaatgccacattcagag
cggtcagcgtcacgggtgcgagagttggctcggctctacagcgagcggatccagcagatg
cagcgagctgagactagggcatccaccaatgcaccccgccgcagacctcgagtcctggcc
caaccccagccatgcccttgcccaccccaggaagaggctgaaccaggagccctgcctgca
tttggacatgtgcttgtatgtgagctggccttcccactgaactgtgcccaggagtctgtc
cctctgggccctgctgctctggttcaagctgccacacctttgtgtacacaaggagatgac
ctgagtggccagagtctgactgtttcagatttgcccaagcaaggccatctgagtaataac
tgcattccacctcctgtccctttgcctgggcaaagcaacttccagagcctccaggttcca
tctgcatcccttttgcccaagcaagatcctccagatgttcagctcccaactgcctcaacc
ttgcctgatacaggtcagctgcaagttccagctgcggctccttcaactgagcatagaaac
tatgtggagatccaggttcagtccaccaccacttcccttcctggccaagagtgtccggca
gactttcagatgccaaccactgcggcattgcccaggcaagaaggtcatgaagacagccga
agcccaaacagtgctccaggagccgagcaaagagatgtcggcgtcgatcagggccccact
gctgttgatggccaagctgtcagccctctgccagcgtgcacaagcagccctgaccatcat
cagatcccagccactccgctgccattgtcacctgacctcccagacatggagggtgctggt
gccttacctctgcccgcacagcaaggtcatccagactgctgcgtcccatgcgaccctcta
ccatctctgccccaagacgttcagacgccaacggtcatccccatgtcccagcctcaaggc
cttacagacgtcagggccaaagtgcccccgtctttccccacacaggaggaagctccagag
tttctgggtccagagcccagcctcacagacaccccagctcccagactcttaccttcatca
ggccaacagaacaccacagatggccatgtttcaacagctgccgtgccttgccctgaacaa
ggatgccctcaagatattcaaggcctaataacttccccggtccagacgaccatggagcta
cccaaaccaaggggtttagtctctcgggttgccacttcagagtctctggacttgaccccg
ccacatagcccctcgctgtccactcgccagctcctgggacccagcgcagctgccctctca
aggtacctggcagcttcgtacatcagccagagcttggctcggcgccagggccctggggga
gagggcatggcagcctcccagggtcactggtcctcctctgcccccacatcacgggcacct
tcacccccacctcagccccagcccccagctcctccagctaggaggctcagctatgccacc
acagtgagcattcaggtaggaggtggtgggaggctacgaccagctagagctcaggtccgg
ctaaaccaccctgctctcttggcagccccccacccaggagccttcgggccttcccagggc
ccagaaggctcctga

DBGET integrated database retrieval system