KEGG   Rattus norvegicus (rat): 29278
Entry
29278             CDS       T01003                                 

Gene name
Lasp1
Definition
(RefSeq) LIM and SH3 protein 1
  KO
K24420  LIM and SH3 domain protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    29278 (Lasp1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  LASP family proteins
   29278 (Lasp1)
SSDB
Motif
Pfam: Nebulin SH3_9 SH3_1 LIM SH3_2 DUF4107 zf-C2HC5
Other DBs
NCBI-GeneID: 29278
NCBI-ProteinID: NP_116002
RGD: 68408
Ensembl: ENSRNOG00000004132
UniProt: Q99MZ8
Position
10q31
AA seq 263 aa
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPSGGEGIEPERREAQDSSSYRRPTEQQQPQPHHIPTSAPVYQQPQQQQ
VTPSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDG
WMYGTVERTGDTGMLPANYVEAI
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaccctaactgtgcccggtgcggcaaaatcgtgtaccccacggagaaggtgaactgt
ctggataagttctggcataaagcatgctttcactgcgagacctgcaagatgactttgaac
atgaagaactacaagggttacgagaagaagccttactgcaatgcacactaccccaagcag
tccttcaccatggtggccgacactccggagaacctccgcctgaagcaacagagcgagctg
cagagtcaggtgcgttacaaggaggagtttgagaagaacaagggcaaaggcttcagtgtg
gtggcagacacgcctgaactgcagagaatcaagaagacccaggaccagatcagcaatatc
aaataccatgaggagtttgagaagagccgcatggggcccagcggaggtgaaggcatagag
ccagagcgccgagaagcccaggacagcagcagctaccggaggcccacggagcagcaacag
ccacagccccaccatatcccgaccagtgccccagtttaccagcagccccaacagcagcag
gtgaccccgtcctatggtgggtacaaggagccagcagcccctgtctccatacagcgcagt
gccccaggtggcggcgggaaacggtaccgtgcagtgtatgactacagcgctgccgatgag
gacgaggtctccttccaggatggggacaccatcgtcaatgtgcagcagatcgatgatggc
tggatgtatgggaccgtagagcgcaccggtgacacggggatgctgccagccaactatgtt
gaggccatctga

DBGET integrated database retrieval system