KEGG   Rattus norvegicus (rat): 292994Help
Entry
292994            CDS       T01003                                 

Gene name
Tjp1, ZO-1
Definition
(RefSeq) tight junction protein 1
  KO
K05701  tight junction protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04520  Adherens junction
rno04530  Tight junction
rno04540  Gap junction
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    292994 (Tjp1)
   04530 Tight junction
    292994 (Tjp1)
   04540 Gap junction
    292994 (Tjp1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    292994 (Tjp1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     292994 (Tjp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ ZU5 PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1 RPOL_N
Motif
Other DBs
NCBI-GeneID: 292994
NCBI-ProteinID: NP_001099736
RGD: 1306305
Ensembl: ENSRNOG00000011077
UniProt: F1M4A0
Position
1q22
AA seq 1733 aa AA seqDB search
MEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQEN
DRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPDPDPVSDNEDDSY
DEDVHDPRSGRGALANRRGEKSWARDRSASRDRSLSPRSDRRSVASSQPAKPTKVTLVKS
RKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERS
KGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSVRSHDRPPRRSQ
SRSPDQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAVSTPVKHVDDHTPKAVEEVTV
EKHEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPSMKLVKFRKGDS
VGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPK
GEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNG
KLGSWLAIRIGKNHKEVERGIVPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKR
NLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIA
KSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDS
KQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQ
QQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGA
YTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQAIHRIDS
PGLKTASQQKAEASSPVPYLSPETNPASSASAVKHNVNLTNVNLEEPTPAPPTSHVSQAD
CLGAPSPEAPHTMLRDEGVSLPSHVDPAKVYRKEPYPEEMMRQNHILKQPALGHPGQRLD
KEPNPAYDPQLPYVEKQASRDLEQPPYRYESSSYTDQFSRNYDHRLRFEDRVPTYEDQWS
YYDDKQPYPTRPFDTQHPRDLDSRQHPEEASERGYFQRFEEPAPLPYDSRPRYEQLPRTS
TLRHEEQPTSGYEVHNRYRPEAQPYAPAGPKSSEPKQYFDQYPRSYEQVPPPGFTSKTGH
YEPLHGAAVVPPLIPSSQHKPEVLPSATKPQPPPPALTEEEEDPAMKPQSVLTRVKMFEN
KRSASLENKKDVNDTASFKPPEVASKPPSASLVGPKPVSQTQFSEHDKTLYRLPEPQKPQ
AKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFESKPPAHIPAGHHSEPAKPVHSQSQP
NFSSYSSKGKPETDAMDRSFSEKRYDPTQAMPPPPPLPSQYSQPVPPLSNSSLHIHSKAA
QSEGNSVSLDFQNSYISKPDPPPSQSKPATFRPPTREDPPQTFYPQKSFPDKASVNGAEQ
TQKTITPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPELSSKPPPSPKTLM
KAHSSTQPPEFDSGVETFSVHTDKPKYQINNISTMPKAVPVSPSAVEEDEDEDGHTVVAT
ARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGETLLS
PLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
NT seq 5202 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaacagctatatgggaacagcacacagtgacgcttcacagggctcctgggttt
ggatttggaattgcaatatctggtggaagagataatcctcattttcagagtggggaaacc
tccatagtgatttctgatgtgctaaaaggagggccagctgaaggacagctacaggaaaat
gaccgagtcgcaatggttaacggagtttcaatggataatgttgaacatgcttttgctgtt
cagcagctaaggaaaagtgggaaaaacgcaaaaattaccatccgaagaaagaagaaagtt
cagattcctgtaagtcacccagaccctgacccagtgtctgataatgaagatgatagctat
gacgaggatgtgcacgatccaagaagtggccgaggtgccctagctaacagaaggggtgag
aagagctgggcaagggatagaagcgcaagcagggaccggagcctgtcccctcgctcagac
aggcgatcagtggcctccagtcagcccgccaaacccaccaaggtcacattggtgaagtct
cggaaaaatgaagaatatggtcttcgattggccagccatatatttgtaaaggaaatttca
caagatagtttggcagcaagagatggtaacattcaagaaggggatgttgtcctgaagata
aatggtactgtgacagaaaatatgtcactgacagatgcaaaaacattgatagaaaggtct
aaaggcaagttaaaaatggtagtgcaaagagatgagcgggctaccttattgaatgtccct
gatctttcagatagtatccattctgctaatgcctctgaaagagatgacatttcagaaatt
cagtcactagcatcagaccattcagttcgctcccatgacaggcctccccgccgaagccag
tcacgatctcccgaccaacgttcagagccctctgatcattccacacagtctccacagcag
cccagcaatggcagtctccggagcagagaggaagagcgcatgtctaaacccggggctgtc
tcaactcctgtaaaacatgtagatgatcatacacccaaagcagtggaagaagttacagtt
gaaaaacatgagaagcagacacccactcttccagaaccaaaacctgtatatgctcaagtc
ggacagccagatgtggatttacctgtcagcccttctgatggtgttctgccaaattcaaca
catgaagatgggattcttaggcccagcatgaaactggtaaaattcagaaaaggagatagt
gtgggtttgcgactagctggtggaaatgatgtcggaatatttgtagctggcgttctagaa
gatagccctgcagccaaagaaggcttagaggaaggtgatcaaattctcagggtgaacaat
gtagatttcacaaatatcataagagaagaagctgttcttttcctcctcgacctccctaaa
ggtgaagaagtgaccatattggctcagaagaaaaaggacgtttatcgccgcattgtagag
tcagatgtaggagactcgttctatattagaacacattttgaatatgagaaagaatctcct
tatggactcagttttaacaaaggagaggtgttccgggtcgtggacaccctgtacaacggg
aagctgggctcctggctggccattcgaattggcaaaaatcacaaggaggtagagcgaggc
atcgttcctaataagaacagagccgagcagttagccagtgtacagtacacacttccaaag
acagcaggtggcgatcgggcagacttctggaggtttcgaggtcttcgtagctccaagaga
aatcttcgaaaaagcagagaggacctgtcagcgcagccagttcaaacaaagttcccagct
tatgaaagggttgttcttcgagaagctggattcctaagacctgtaaccatctttggaccg
attgctgatgttgccagagaaaagttagcaagggaggagccagacatttatcagattgca
aaaagtgaaccacgagatgctggaactgaccatcggagctcgggcattattcgccttcat
acaataaagcaaatcatagatcaagataaacatgctttattagatgtcacaccaaatgca
gtcgatcgccttaattatgcacagtggtatccgattgttgtgttccttaaccctgactct
aagcagggtgtaaaaacaatgaggatgaggctatgtccagagtctcggaaaagtgccagg
aagctatatgaacggtctcataaacttcgtaaaaataatcaccatctttttacaaccaca
attaacttaaactcaatgaatgatggttggtatggtgccctgaaagaagcgattcagcag
caacagaaccagctggtgtgggtctctgaggggaaggcggatggtgctacaagtgatgac
cttgatttgcatgatgatcgtctgtcctacctgtcagccccaggtagtgagtactcaatg
tatagcacggacagtagacacacttctgactatgaagacacagatacagaaggcggggcc
tacactgatcaagaactagatgaaactcttaatgatgaggtggggactccaccggagtct
gctattacacggtcctctgagcctgtaagagaggattcctctggaatgcatcatgaaaac
caaacatatcctccttactcaccacaagcgcagccacaagctattcatagaatagactcc
cctggacttaagacagcctctcaacagaaagcagaagcctcatctccagtcccttacctt
tcgcctgaaacaaacccagcatcatcagcctctgcagttaagcataatgtaaatttaact
aatgtcaacctggaggagcccaccccagctcctcccacctcgcacgtatcacaagctgat
tgtttaggagcaccaagtcctgaggcacctcacacgatgctcagagacgaaggagtgtca
ttgccgtcgcatgtagacccagcaaaggtatataggaaggagccatatcctgaggaaatg
atgagacaaaaccatattttaaaacagccagctcttggtcatccagggcagaggctggat
aaagagccaaatccagcctatgatccccaacttccatatgtagaaaaacaagccagcaga
gaccttgagcagccaccatacaggtatgagtcctcaagctacacagaccagttttctcgg
aactatgaccatcgcctacgatttgaagaccgagtccctacctatgaagaccagtggtca
tattatgatgacaaacagccctacccaactcggccctttgatactcagcatcctcgagac
ttggactccagacagcatcctgaagaggcttcagaacgaggctatttccagcgttttgaa
gagcccgcccctctgccatatgacagtagaccacgctacgagcagctgcctcgaacctct
actctccgacatgaagaacagccaaccagtggatatgaggtgcacaacaggtacaggcca
gaagcacagccctatgctccagcaggtcctaagtcatctgagccgaagcagtactttgac
cagtacccacgaagttatgagcaagtaccaccaccaggatttacctccaaaacaggccat
tacgagcctctccatggtgctgcagttgttcctcctctgataccttcctctcaacataag
ccagaagttctgccctcagctaccaagccacagcctccgcccccagccctaactgaggaa
gaggaggatccagcaatgaaaccacagtctgtgctcaccagggtcaaaatgtttgaaaac
aaaagatctgcgtctctggagaacaagaaggatgtgaatgacactgccagctttaagcct
ccagaagtagcatctaaacctccaagtgcttctcttgttggccctaaacctgtttctcag
actcagtttagtgagcatgacaaaacactctacaggctcccagagcctcagaaacctcaa
gcgaagccacctgaagatattgttcgatcaaatcattacgatcctgaagaggatgaagag
tattaccggaaacagctctcttactttgaccggagaagtttcgagagcaagcctcctgca
catattcctgctggccatcactcagagcctgccaagccagtccattctcagagtcagccg
aatttctctagttattcttcaaaggggaaacccgaaactgatgctatggatagatcattc
agtgagaaacgttatgatccaacccaggccatgcctcctcctcctccgttgccctcacag
tacagccagccagttccgcctctgtccaactcttctctccacatacattccaaggccgcc
cagagtgaaggcaattccgtatcgttggattttcagaactcatatatatccaaaccagac
ccacccccatctcagagcaaaccagcaacttttagaccaccaacccgggaggaccctcct
cagaccttctatccccagaaaagtttcccagacaaagcttcagttaatggagctgagcag
actcagaaaaccatcactccagcatacaaccgattcacaccaaagccgtacacgagctct
gcccggccatttgaacgcaagtttgaaagtccaaagttcaaccataatcttctgccaagt
gaaactgtacataaacctgaattgtcttcaaaacctcccccttctccaaaaactctcatg
aaggctcatagttccacacagccgcctgagtttgacagtggagtcgagactttctctgtt
cacacagataagcctaaatatcaaataaataatatcagcaccatgcctaaagctgttcct
gtgagtccttcagctgtggaagaagatgaagatgaggatggtcatactgtagtggctaca
gcccgcggcatttttaacagcaatggcggtgtgttgagttccatagaaactggtgttagt
ataattatcccacaaggagccattcctgaaggaattgagcaagaaatctatttcaaagtc
tgcagagacaatagcatcctcccacctttagataaagagaaaggtgaaactctgctgagc
cccctagtgatgtgcgggccccatggcctcaagttcctgaagcctgtggagctacgcttg
ccacactgtgaccctaaaacttggcaaaacaagtgtcttcctggagatccgaattacctt
gttggagccaactgtgtttctgtcctgattgaccacttttaa

DBGET integrated database retrieval system