KEGG   Rattus norvegicus (rat): 29328
Entry
29328             CDS       T01003                                 

Gene name
Gpx4
Definition
(RefSeq) phospholipid hydroperoxide glutathione peroxidase isoform A precursor
  KO
K05361  phospholipid-hydroperoxide glutathione peroxidase [EC:1.11.1.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    29328 (Gpx4)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    29328 (Gpx4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.12  phospholipid-hydroperoxide glutathione peroxidase
     29328 (Gpx4)
SSDB
Motif
Pfam: GSHPx AhpC-TSA
Other DBs
NCBI-GeneID: 29328
NCBI-ProteinID: NP_058861
RGD: 69226
Ensembl: ENSRNOG00000013604
UniProt: P36970
Position
7
AA seq 197 aa
MSWGRLSRLLKPALLCGALAVPGLAGTMCASRDDWRCARSMHEFAAKDIDGHMVCLDKYR
GCVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA
AGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRY
GPMEEPQVIEKDLPCYL
NT seq 594 nt   +upstreamnt  +downstreamnt
atgagctggggccgtctgagccgcttattgaagccagcactgctgtgcggggctctggct
gtgcctggcctggctggcaccatgtgtgcatcccgcgatgattggcgctgtgcgcgctcc
atgcacgaattcgcagccaaggacatcgatgggcacatggtttgcctggataagtacagg
ggttgcgtgtgcatcgtcaccaacgtggcctcgcaatgaggcaaaaccgacgtaaactac
actcagctagtcgatctgcatgcccgatacgccgagtgtggtttacgaatcctggccttc
ccttgcaaccagttcgggaggcaggagccaggaagtaatcaagaaatcaaggagtttgca
gccggctacaatgtcaggtttgacatgtacagcaagatctgtgtaaatggggacgatgcc
cacccactgtggaaatggatgaaagtccagcccaagggcaggggcatgctgggaaatgcc
atcaaatggaactttaccaagtttctcattgataagaacggctgcgtggtgaagcgctat
ggtcccatggaggagccccaggtgatagagaaggacctgccgtgctatctctag

DBGET integrated database retrieval system