KEGG   Rattus norvegicus (rat): 29337Help
Entry
29337             CDS       T01003                                 

Gene name
Plcg2
Definition
(RefSeq) phospholipase C, gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04020  Calcium signaling pathway
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04611  Platelet activation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    29337 (Plcg2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    29337 (Plcg2)
   04012 ErbB signaling pathway
    29337 (Plcg2)
   04370 VEGF signaling pathway
    29337 (Plcg2)
   04064 NF-kappa B signaling pathway
    29337 (Plcg2)
   04066 HIF-1 signaling pathway
    29337 (Plcg2)
   04020 Calcium signaling pathway
    29337 (Plcg2)
   04070 Phosphatidylinositol signaling system
    29337 (Plcg2)
   04072 Phospholipase D signaling pathway
    29337 (Plcg2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    29337 (Plcg2)
   04625 C-type lectin receptor signaling pathway
    29337 (Plcg2)
   04650 Natural killer cell mediated cytotoxicity
    29337 (Plcg2)
   04662 B cell receptor signaling pathway
    29337 (Plcg2)
   04664 Fc epsilon RI signaling pathway
    29337 (Plcg2)
   04666 Fc gamma R-mediated phagocytosis
    29337 (Plcg2)
   04670 Leukocyte transendothelial migration
    29337 (Plcg2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    29337 (Plcg2)
  Nervous system
   04722 Neurotrophin signaling pathway
    29337 (Plcg2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29337 (Plcg2)
  Development
   04360 Axon guidance
    29337 (Plcg2)
   04380 Osteoclast differentiation
    29337 (Plcg2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    29337 (Plcg2)
   05206 MicroRNAs in cancer
    29337 (Plcg2)
   05205 Proteoglycans in cancer
    29337 (Plcg2)
   05225 Hepatocellular carcinoma
    29337 (Plcg2)
   05214 Glioma
    29337 (Plcg2)
   05223 Non-small cell lung cancer
    29337 (Plcg2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    29337 (Plcg2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    29337 (Plcg2)
   05169 Epstein-Barr virus infection
    29337 (Plcg2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    29337 (Plcg2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     29337 (Plcg2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    29337 (Plcg2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    29337 (Plcg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 29337
NCBI-ProteinID: NP_058864
RGD: 3348
Ensembl: ENSRNOG00000051986
UniProt: P24135
Structure
PDB: 

Position
19q12
AA seq 1265 aa AA seqDB search
MTTMVNVDTLPEYEKSQIKRALELGTVMTVFSARKSTPERRTVQMIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRHKADCCFTIFYGTQFVLSTLSLATDSKEDAV
KWLSGLKILHQEAMNASTPTMIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSGI
KFLKDKLVEIGAQKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLQDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRAGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFVTSSFPVILSIEEHCSVEQQRHMAKV
FKEVLGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKTQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEDPVQDTPPTELHFGEKWFHKKVESR
TSAEKLLQEYCAETGAKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGVMKYY
LTDNLTFNSIYALIQHYREAHLRCAEFELRLTDPVPNPNPHESKPWYYDRLSRGEAEDML
MRIPRDGAFLIRKREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISAGDAEEMEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKAFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWERNQSIAIELSDLVVYCKPTSKTKDHLENPDFREIRSFVE
TKADSIVRQKPVDLLRYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRSEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDSNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFLVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRGANRDALVKEFNVNENQLRLYQEKCNRRLREKRVSN
SRFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatggtcaacgtggacacccttccagaatatgagaagagtcagatcaagaga
gccctggagctagggacggtgatgaccgtattcagtgcccgcaaatccaccccagagcgg
aggacagtacagatgatcatggagacccggcaggtggcatggagcaagacagcagataag
atcgaaggcttcttggacatcatggaaataaaggaaatccggccagggaagaactccaag
gactttgagcgagccaaggctgtccgtcacaaggcagactgctgcttcaccatcttctac
ggcacccagttcgtgctcagcactctcagtctggcaaccgactcaaaggaggatgcagtg
aagtggctctctggcttgaagatcttacaccaggaagcgatgaacgcatccactcccaca
atgattgagagttggctgcggaaacagatttattcagtagatcaaacccgaagaaacagc
atcagcctccgggagctgaagaccatcttgcccctggtcaacttcaaagtgagcggcatc
aagttcctcaaggacaagctggtggaaattggcgcccagaaagatgagctcagttttgaa
cagttccatctcttctataaaaaactcatgtttgagcagcagaagtcgatacttgacgaa
ttcaaaaaagactcctccgtgttcatcctagggaacacagaccggcctgatgcctcagcc
gtctacctgcaagacttccagaggtttcttttacatgaacagcaggagctatgggctcag
gatctgaacaaagtccgggagcggatgaccaagtttatcgatgacacaatgagggagacc
gcagagcccttcttgtttgtggatgagttcctcacgtatctgttctcacgggagaacagc
atctgggacgagaagtacgatgccgtggacatgcaggacatgaacaaccccttgtcccat
tactggatctcctcttcccacaacacgtacctcactggagaccagctgcgtagcgagtcc
tccacggaagcgtatatccgctgtctgcgtgctggttgtcgctgcatcgagttggattgc
tgggatgggcctgacgggaaacccataatctatcacggttggacacggaccaccaagatc
aagtttgatgatgttgttcaggccatccgggatcatgcctttgttacctccagctttccc
gtgattctgtctatcgaggagcactgcagtgtggagcagcaacgtcacatggccaaggtc
ttcaaggaagtgttaggagacctgctgttgacgaagcccacggaggccagtgctgaccag
ctgccctcacccagccagcttcgtgagaagatcattatcaagcataagaagctgggcccc
cgaggtgatgtcgatgtcaatgtggaggacaagaaagatgagcacaagacccagggcgag
ctgtatatgtgggactccatcgaccagaaatggactcgccactactgtgctattgcggac
gccaagctgtccttcagtgacgacattgaacagactgtggaagaggatccggtccaggac
actccccccacggagctacattttggggagaaatggttccataagaaggtggagagcagg
accagtgcggagaagctgctgcaggagtactgtgccgagactggggccaaggatggcacc
ttcctggtgcgggagagcgagaccttccccaacgactacacactctccttctggcggtct
ggccgggtgcagcactgccgaatccggtctaccatggagggtggggtcatgaagtactac
ctgactgacaacctcacgttcaacagcatctacgccctcatccagcactaccgggaggca
cacctgcgctgtgcggagttcgagctgcggctcacagacccggtgcccaaccccaaccca
catgagtccaagccgtggtactatgacaggctgagcaggggggaagcagaggacatgttg
atgcggattccccgagatggagccttcctcattcggaagcgggaggggaccgactcttac
gccatcaccttcagggccaggggcaaggtgaaacattgccgtatcaaccgggacggacgt
cactttgtgctggggacctctgcctactttgagagcctggtggagctcgtcagctactat
gagaagcacgcactctaccgcaagatgaggcttcgctaccccgtgaccccggagctcctg
gaacgatataatatggaaagagacatcaactctctctatgacgtcagcaggatgtatgtg
gacccaagtgagatcaacccttccatgcctcagaggactgtgaaagcactctatgactac
aaagccaagcgcagcgatgagctgaccttctgccgaggtgccctcatccacaacgtctcc
aaggagccgggaggatggtggaaaggggactatgggacccggatccagcagtatttccca
tctaactacgttgaagatatctcggcaggcgatgctgaggagatggaaaagcagattatt
gaagacaaccccctcgggtctctctgcagaggcatattggatcttaatacctacaatgtg
gtgaaggccccccaggggaaaaaccagaaagccttcgtctttatcctggagcctaagaaa
cagggggaccctcctgtggagttcgcgactgaccgtgtggaggaactgtttgagtggttt
cagagtatacgagagatcacttggaagatcgacaccaaggagaacaacatgaagtactgg
gagaggaatcagtccattgctattgagctctctgacttggttgtgtactgcaagccgact
agcaaaaccaaggaccatttggaaaatcctgacttccgggaaattcgctcttttgtggag
acaaaggcagacagcattgtcaggcaaaagcccgtggatctattgcggtacaaccagaag
ggcctgacccgtgtctaccccaagggacagagagttgactcttccaactacgaccccttc
cgtctgtggctgtgtggctcccagatggtggcgctcaatttccagactccagacaagtac
atgcagatgaaccatgcattgttttcgctcaatgggcggacaggttacgtcctgcagccc
gagagcatgcggtctgagaagtatgacccgatgcccccggagtcccagaggaagatcctg
atgacactcactgtcaaggttcttggtgcacgccacctccctaaactagggcggagtatc
gcctgtccctttgtagaggtggaaatctgtggggccgagtatgacagcaacaaattcaag
acgacggttgtgaatgacaacggtctcagccctgtctgggctccaactcaggagaaggtg
acatttgaaatttatgacccaaaccttgcgttcctacgctttctggtctacgaagaagac
atgttcagtgaccccaacttcctggctcatgccacataccccattaaaggcatcaaatca
ggatttagatcagtccctctgaagaacgggtacagtgaagacatcgagctggcatccctc
ctggttttctgtgagatgcggccagtcctggagagtgaagaagaactctattcctcctgt
cgccagctgcggaggcggcaggaagagctcaacaaccagctcttcctgtatgacacacac
cagaacctgcgaggagccaaccgggatgccctggtgaaggagttcaatgttaacgagaat
cagctgcggctgtaccaggagaagtgtaaccggaggctgagagagaagagagtgagtaac
agcaggttctactcctag

DBGET integrated database retrieval system