KEGG   Rattus norvegicus (rat): 293502Help
Entry
293502            CDS       T01003                                 

Gene name
Kif22
Definition
(RefSeq) kinesin family member 22
  KO
K10403  kinesin family member 22
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    293502 (Kif22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    293502 (Kif22)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     293502 (Kif22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd HHH_3 HHH_6
Motif
Other DBs
NCBI-GeneID: 293502
NCBI-ProteinID: NP_001009645
RGD: 1311886
Ensembl: ENSRNOG00000020281
UniProt: Q5I0E8
Position
1q37
AA seq 657 aa AA seqDB search
MNVRAKKKPQQREMASASSGPSRSLSKGGVSRRPPLARVRVAVRLRPFMDEAKEPPCVRG
IDSCSLEVANWRKYQETLKYQFDAFYGEKSTQQDVYVGSVQPILRHLLEGQNASVLAYGP
TGAGKTHTMLGSPEQPGVIPRALMDLLQLTREESAEGRPWDISVAMSYLEIYQEKVLDLL
DPASGDLVIREDCRGNILIPGLTQKPITSFSEFEQHFLPASRNRVVGATRLNQRSSRSHA
VLLVKVEQRERLTPFRQREGKLYLIDLAGSEDNRRTGNQGIRLKESGAINTSLFVLGKVV
DALNQGLPRIPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYQDTISALNFTARSKEV
INRPFTNESLQPHALAPVKLPQKELLGPSEAKKAKGPEEESTGSPESTAAPASASQKLSL
LQKLSNMDPAMLENLLSMERLLGSQGSQGIPLLNTPKRERMVLIKTVEEKNLEIERLKMK
QKELEAKVLAQEALDPKEKENTPTILQPSSSCSGSVAKPLKKAVVMPLQRIQKQSESSNK
IHLLKKGHKRKLESSHESEAVEKDEDYWEIQISPELLARGRKKLLHLLNEGSARDLRSLQ
RIGQKKAQLIVGWRELHGPFNEVEDLEQVEGISGKQVESFLKANLLSLAASQHSGPS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttagggctaagaaaaagccgcagcaacgggagatggcgtcggccagctcagga
cccagtcgctctctaagcaagggaggagtcagcagacgtcctcctctagctcgagtaagg
gtggccgtgcgactgcgcccatttatggatgaagcaaaggaaccaccctgtgtgcgaggc
atagacagctgctctcttgaagtagccaactggaggaaataccaggagactctaaaatat
cagtttgatgctttctatggagagaagagcactcagcaagatgtctatgtgggttcagta
cagcccattctcaggcacttgctggaagggcagaatgccagtgtacttgcctatgggcct
actggggcagggaagacacacacaatgctgggtagcccagaacagcctggagtgattcct
cgggctctcatggacctcctgcaactaacaagggaagagagtgctgagggccggccctgg
gacatttctgttgctatgtcctatttggagatctaccaggaaaaggtattagacctcttg
gatcctgcatcaggagacctagtgatccgagaggactgtcgagggaacatcctgattcca
ggcctcactcagaagcccatcactagcttctctgagttcgagcagcacttccttccagcc
agtagaaatcgagtcgtaggagctacccggcttaaccagcgctcttcccgcagtcatgcg
gtgctcttggtcaaggtagaacagcgtgaacgtttgactccatttcgccagcgggaagga
aaactctaccttattgatttggctggttcagaggacaaccgtcgcacaggcaaccaggga
attcggctaaaagagagtggagccatcaacacctccctctttgtattgggcaaagtggtg
gatgcattaaaccagggcctccctcgtataccataccgggacagcaagctcactcgtctg
ctgcaggactctctgggaggttcagctcatagcatcctcattgccaacatcgctcctgaa
aggcgtttttaccaggatacgatctcagcattgaacttcactgcgaggtccaaggaggtg
attaaccggcctttcaccaatgagagcctacagcctcatgccttggcacctgttaagctg
cctcagaaagaactgctaggcccatcagaggcaaagaaagccaaaggccctgaagaagaa
tcaactgggagccctgagtctacagcagctccagcatctgcctcccagaaattaagcctc
ttacagaagctaagcaatatggatccagccatgttggagaacctcctgagtatggaacgt
ttgctgggttcccaggggagccaagggatacctctactgaataccccaaagcgagagcga
atggtactcattaagacagtggaggaaaagaacttagagattgagaggcttaagatgaag
caaaaagaactggaagccaaggtgctggcccaggaggcactggatccaaaggaaaaagag
aacactcccacaattctccagccctcttcctcctgtagtggctcagtggctaagcccctg
aaaaaggctgtggtgatgcccctgcaacggattcagaagcagtcagagtcctcaaacaag
atccacctcctgaagaaaggccacaaaaggaagctggagtcatcacatgagtcagaagct
gtggaaaaggatgaggactactgggagatacaaattagcccagagttactggcacggggg
cgcaaaaaattattgcatctgctgaatgaaggctcagctcgggatctgcgaagcctgcag
cgaattggccagaagaaggcccagctcattgtgggctggagggagctgcatggccccttt
aatgaggtggaggacctggaacaggtggaaggcatctctgggaagcaggtagagtctttc
ctgaaggcgaatctcttgagcttggctgccagccagcacagtggtccctcttga

DBGET integrated database retrieval system