KEGG   Rattus norvegicus (rat): 293601
Entry
293601            CDS       T01003                                 

Gene name
Olr303
Definition
(RefSeq) olfactory receptor 303
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    293601 (Olr303)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    293601 (Olr303)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    293601 (Olr303)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF3963
Other DBs
NCBI-GeneID: 293601
NCBI-ProteinID: NP_001000239
RGD: 1333730
Ensembl: ENSRNOG00000047015
UniProt: D4A7A7
Position
1q41
AA seq 307 aa
MASGNQSAITMFILQSFIDDPWIQNVLFCLFFALFVAAIAGNGLIITVIHSSANLHTPMY
FFLVNLSLMDVICTVTVLPKVLQSLVAENAISYGGCLTQMFIFTWVLGSELLLFSAMAYD
RYLAICRPLHYGTLMSGRVCMALATFVWFIGALNSLVLTCLVLPLSFCGPNLITHFFCEI
PSVLTLSCSPTFTNDIMTVVADMFLTGLNFLLTMTSYVFIIASILRIRSAEGKKRAFSTC
SAHLVVVTLYYSTALYTYVRPALGNAGLLDKFIAIPYTTVTPSLNPLIYTLRNKEFKTSF
KRLLFAH
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcttctggaaaccagtcagctattaccatgttcatcctgcaaagctttattgatgac
ccctggatccagaatgttctcttttgccttttctttgccttgttcgtggcagccatagct
ggcaatggcctgattatcacagtcatccacagcagtgccaacctccacactcccatgtac
ttcttcctagtcaatctttccctcatggatgtgatctgcactgtgactgtcttgcctaaa
gtcctgcagagcctggtggcagagaacgccatttcttatgggggatgtctcacacaaatg
ttcatcttcacctgggtactgggctctgagcttctgcttttttctgccatggcctatgac
cgctaccttgcaatctgccggccactgcactatggtaccctcatgagtggcagggtctgc
atggcccttgcaacctttgtgtggttcattggagctctcaattccttggtgctcacttgt
ctggtgttgccactgtccttctgtggtcctaatctcatcacacacttcttctgtgagatc
ccctccgtgttgacactgtcctgcagccccacatttaccaatgacatcatgactgttgtt
gcagacatgttcctgacaggcctgaacttcctattgaccatgacatcctatgtgttcatc
attgccagcatcctgcgcatccgctcagctgagggcaagaagcgcgccttctccacctgc
tctgctcacctggttgtggtcaccctttattattccactgctctatatacttatgtccgg
ccagccctaggaaatgctggactcctggacaagttcattgctattccatacaccactgtg
accccgtctctgaaccctctcatctatactctgagaaacaaagaattcaaaacatccttt
aaaagacttttatttgcccattga

DBGET integrated database retrieval system