KEGG   Rattus norvegicus (rat): 29393Help
Entry
29393             CDS       T01003                                 

Gene name
Col1a1, COLIA1
Definition
(RefSeq) collagen type I alpha 1 chain
  KO
K06236  collagen, type I, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04974  Protein digestion and absorption
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    29393 (Col1a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    29393 (Col1a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29393 (Col1a1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29393 (Col1a1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    29393 (Col1a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    29393 (Col1a1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29393 (Col1a1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29393 (Col1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    29393 (Col1a1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    29393 (Col1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29393 (Col1a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   29393 (Col1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI VWC
Motif
Other DBs
NCBI-GeneID: 29393
NCBI-ProteinID: NP_445756
RGD: 61817
Ensembl: ENSRNOG00000003897
UniProt: P02454
Structure
PDB: 

Position
10q26
AA seq 1453 aa AA seqDB search
MFSFVDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWKPDVCLICICHNGTAV
CDGVLCKEDLDCPNPQKREGECCPFCPEEYVSPDAEVIGVEGPKGDPGPQGPRGPVGPPG
QDGIPGQPGLPGPPGPPGPPGPPGLGGNFASQMSYGYDEKSAGVSVPGPMGPSGPRGLPG
PPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQG
ARGLPGTAGLPGMKGHRGFSGLDGAKGDTGPAGPKGEPGSPGENGAPGQMGPRGLPGERG
RPGPPGSAGARGNDGAVGAAGPPGPTGPTGPPGFPGAAGAKGEAGPQGARGSEGPQGVRG
EPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGAPGPKG
NSGEPGAPGNKGDTGAKGEPGPAGVQGPPGPAGEEGKRGARGEPGPSGLPGPPGERGGPG
SRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDG
KTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGVPGPPGAVGPAG
KDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPG
PSGARGERGFPGERGVQGPPGPAGPRGNNGAPGNDGAKGDTGAPGAPGSQGAPGLQGMPG
ERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGETGPSGPAG
PTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDTGVKGDAGPPGPAGPAGPPG
PIGNVGAPGPKGSRGAAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPVGKEGGKGPRG
ETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGSPGTPGPQGIAGQRGVVGLPGQRGERG
FPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPG
AKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQG
PRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPG
KDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQD
GGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKS
GEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMT
DGFQFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKSLLLQ
GSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPD
QEFGMDIGPACFV
NT seq 4362 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctttgtggacctccggctcctgctcctcttaggggccactgccctcctgacg
catggccaagaagacatccctgaagtcagctgcatacacaatggcctaagggtccctaat
ggtgagacgtggaaacctgatgtatgcttgatctgtatctgccacaatggcacggctgtg
tgcgatggcgtgctatgcaaagaagacttggactgtcccaacccccaaaaacgggagggc
gagtgctgtcctttctgcccagaagaatatgtatcaccagacgcagaagtcataggagtc
gagggacccaagggagaccctggcccccaaggcccacggggacctgttggcccccctgga
caagatggcatccctggacagcctggacttcctggtcctcctggtccccccggccccccc
ggaccccctggtcttggaggaaactttgcttcccagatgtcctatggctatgatgagaaa
tcagctggagtttccgtgcctggccccatgggtccttctggtcctcgtggtctccctggc
ccccctggtgcacctggtcctcaaggtttccaaggcccccctggtgaacctggcgagcct
ggcgcttcaggtccaatgggtccccgaggtccccctggccctcctggcaagaacggagat
gatggggaagctggtaagcctggccgccctggtgagcgtggacctcctggacctcagggt
gctcgtggattgcctggaacagctggcctccccggaatgaagggacacagaggtttcagt
ggtttggatggtgccaaaggagatactggtcctgctggtcctaagggagagcctggcagt
cctggtgaaaatggagctcccggccagatgggtccccgaggtctgcctggtgagagaggt
cgccctggaccccctggcagtgctggtgctcgtggtaacgatggtgctgtcggtgcagct
gggccccccggtcccaccggccctactggccctcctggcttccctggtgcagctggtgct
aagggtgaagctggtccccagggagcccgaggctctgaaggtccccagggtgtgcgtggt
gagcccggaccccctggccctgctggtgctgctggtcctgctggaaaccctggtgctgat
ggacaacctggtgctaaaggtgccaatggtgctcctggtattgctggtgctcctggcttc
cctggtgcccgaggcccctctggacctcagggccccagcggcgctcctggtcccaaaggc
aacagtggtgaacctggtgcccctggcaacaaaggagacactggtgccaaaggagaaccc
ggccctgctggagttcaaggtccccctggccctgctggagaagaaggaaaacgaggagcc
cgtggtgagcctggacctagcggcctgcccggacctcctggcgagcgcggtggacctggt
agccgtggtttccctggtgctgatggtgttgctggccccaagggtcctgctggtgaacgt
ggttctcctggccctgctggtcccaaaggttctcctggtgaagctggtcgccctggtgaa
gctggtctccctggtgccaagggtctcactggcagtcctggcagccctggtcctgatggc
aaaaccggcccccctggtcccgctggtcaagatggtcgccctggacccgcaggtcctcct
ggagcccgtggacaggctggtgtgatgggattccctggacctaagggtactgctggagaa
cctggaaaggctggagaacgaggtgtccccggaccccctggcgctgttggtcccgctggc
aaagatggcgaagctggagctcaaggagcccccggccctgctggtcctgctggtgagaga
ggtgaacaaggtcccgctggctcccctggattccagggtcttcctggtcccgctggtcct
cctggtgaagcaggcaagcctggtgaacagggtgttcctggagaccttggtgcccctgga
ccctctggcgcaagaggcgagagaggtttccctggtgaacgtggtgtacaaggtccccca
ggtcctgctggtccccgaggaaacaatggtgcccccggcaacgatggtgccaagggtgat
actggtgcccccggagctcctggtagccagggtgcccccggtcttcagggaatgcctggt
gaacgtggtgcagctggtcttccaggtcctaagggtgacagaggtgatgctggtcccaaa
ggtgctgatggttctcctggcaaagatggcgtccgtggtctgactggtcccattggtcct
cctggccctgctggtgcccctggtgacaagggtgaaactggtcccagtggtcctgctggc
cccaccggagcccgtggtgcccccggagaccgtggtgagcctggtccccctggtcctgct
ggcttcgctggcccccctggtgctgatggccaacctggtgcgaaaggtgaacctggtgat
actggtgtgaaaggtgacgctggtcctcctggccctgctggtcccgctggaccccctggc
cccattggtaacgttggtgctcctggacccaaaggttctcgtggtgctgctggtccccct
ggtgctactggtttccctggtgctgctggtcgtgttggtccccctggtccctctggaaat
gctggaccccctggccctcccggtcccgttggcaaagaagggggcaaaggtccccgtggt
gagactggtcccgctggacgtcctggtgaagttggtcccccaggtccccctggccctgct
ggtgagaaaggatctcctggtgctgatggacctgctggctctcctggtacccctggacct
cagggtattgctggacagcgtggtgtggtcggtcttcccggtcagagaggagaaagaggc
ttccctggtcttcctggaccctctggtgaacccggcaaacaaggtccttctggagcaagt
ggtgaacgtggtccccctggccctatgggcccccctggattggctggcccccctggtgaa
tctggtcgtgagggatcccctggtgctgaaggctcccctggaagagatggtgctcctggt
gccaagggtgaccgtggtgagactggccctgctggcccccctggtgctcctggtgctcct
ggtgctcccggccctgttggtcctgctggcaagaatggcgaccgtggtgagactggtcct
gctggtcctgctggtcccattggccctgctggtgcccgtggtcctgctggaccccaaggc
ccccgtggtgacaagggtgagacaggcgaacaaggtgacagaggcataaagggtcatcgt
ggcttctctggtctccagggtcctcctggctctcctggctctcctggtgaacaaggcccc
tctggagcttctggtcctgcaggtccccggggtccccctggctctgctggttctcctggc
aaagatggactcaacggtctccctggccccattggtccccctggtcctcgaggtcgcact
ggcgatagtggtcctgctggtccccccggacctcctggaccccctggccctcccggtcct
cccagcggtggttatgacttcagcttcctgcctcagccacctcaagagaagtctcaagat
ggtggccgttactaccgggccgatgatgccaacgtggtccgtgaccgtgaccttgaggtg
gacactaccctcaagagcctgagccagcagattgagaacatccgcagccctgagggcagc
cgcaagaaccccgcccgcacatgccgtgacctcaagatgtgccactctgactggaagagc
ggagagtactggatcgaccctaaccaaggctgcaacctggatgccatcaaggtctactgc
aacatggagacaggtcagacctgtgtgttccccactcagccctctgtgcctcagaagaac
tggtacatcagcccaaaccccaaggagaagaagcatgtctggtttggagagagcatgacc
gatggattccagttcgagtatggaagcgaaggttccgatcctgccgatgtcgctatccag
ctgaccttcctgcgcctgatgtccaccgaggcctcccagaacatcacctatcactgcaag
aacagcgtagcctacatggaccaacagactggcaacctcaagaagtccctgctcctccag
ggctccaacgagatcgagctcaggggcgaaggcaacagtcgattcacctacagcacgctt
gtggatggctgcacgagtcacaccggaacttggggcaagacagtcatcgaatacaaaacc
accaagacctcccgcctgcccatcatcgatgtggctcccttggacattggtgccccagac
caggaattcggaatggacattggccctgcctgcttcgtgtaa

DBGET integrated database retrieval system