KEGG   Rattus norvegicus (rat): 293937Help
Entry
293937            CDS       T01003                                 

Gene name
Pkd2l1
Definition
(RefSeq) polycystin 2 like 1, transient receptor potential cation channel
  KO
K04990  polycystin 2L1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    293937 (Pkd2l1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    293937 (Pkd2l1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   293937 (Pkd2l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel Ion_trans Fer4_24 Golgin_A5
Motif
Other DBs
NCBI-GeneID: 293937
NCBI-ProteinID: NP_001099822
RGD: 1306261
Ensembl: ENSRNOG00000012591
UniProt: D3ZDT6
Position
1q54
AA seq 676 aa AA seqDB search
MNIMENSKEQELQTLGSRVWDNPAYSSPPSPNGTPRICTVSSVALPETQPKKPEVRRQEK
TPRVPVSGCCLLICRGIRGLWGTTLTENTAENRELYVKTTLRELVVYIVFLVDVCLLTYG
MTSSSAYYYTKVMSELFLHTPSESAVSFQTISSMSDFWDGPLLDSLYWTKWYNNQSLGSS
SHSFIYYENLLLGVPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPLNGT
AWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFI
DFSVYNANINLFCILRLVVEFPATGGAIPSWQIRTVKLIRYVNNWDFFIVGCEVIFCIFI
FYYVVEEILEIRVHRFRYLSSVWNILDLVVILLSIVAVGFHVFRTLEVNRLMGELLQQPD
TYPDFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIM
FFIVFFAYAQLGYLLFGTQVESFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFIT
YVFFVFFVLLNMFLAIINDTYSEVKEELAGQRDQLQLSDLLKQSYSKTLQRLRLRKERVS
DVQKVLKGGEPEIQFEDFTNTLRELTRRVLQLQRVLEGVVSQVDALSSKLKMLERKGELA
PSPGMARGASCLGEPL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatggagaattccaaggagcaggagctgcaaacactggggagcagagtctgg
gacaatcctgcctacagcagccctccttccccgaatgggaccccgaggatctgcaccgtc
tccagtgtggctctccctgagactcaacctaaaaagccagaagtcagacgccaggagaag
acaccaagagtccctgtgtccggctgctgtctcctcatctgtcgtggcatcagagggctg
tgggggacaacgctgactgagaacacagccgagaacagagagctttatgtcaagactacc
ctgagggagcttgtggtgtacatcgtgttcctcgtggatgtctgtctgttgacctacgga
atgacaagttctagtgcctattactataccaaagtgatgtccgagctgttccttcacacc
ccgtcagagtctgcagtctccttccagaccatcagcagcatgtcagacttctgggatggc
ccactcctggacagtttgtactggacaaagtggtacaacaaccagagcctggggagcagc
tcccactctttcatctactacgagaacctgctcctgggggtcccgaggttgcggcagctg
cgggtacgcaacgactcctgtgtggttcacgaagatttccgggaggacattttgaactgt
tatgatgtctactctccggacaaagaagaccagctcccctttggacctctcaacggaaca
gcgtggacataccattcacagaatgagctggggggctcctcccactggggcaggctcaca
agctacagtggaggtggctactacttggatcttccaggatccagacaagccagtgcggag
gccctccaaggactccaggagggactatggctagacaggggcactcgtgtggtctttatc
gacttctccgtctacaatgccaacattaatctcttctgtattctgagactggtggtagag
ttcccagccacaggaggggccatcccgtcctggcagatccgcacggttaagctgatccgc
tacgtgaataactgggacttcttcattgtgggctgtgaagtcatcttttgcatcttcatc
ttctactatgtggtagaggaaatcctggaaatccgcgtgcatcggtttcgctacctcagc
agcgtctggaacattctggacctggtggtcatcttgctctccatcgtggctgtggggttc
catgtattccgaaccctggaagtgaaccgactgatgggagagctcctacagcagccagac
acgtatccagactttgagttcctggccttctggcagactcagtacaataacatgaacgcg
gtcaaccttttctttgcttggatcaagatattcaagtacatcagcttcaacaaaaccatg
acccagctctcctccaccctggctcgctgtgccaaggacatcctgggtttcgccatcatg
ttcttcattgtcttcttcgcctacgcccagctcggctacctgcttttcgggacccaagta
gaaagctttagcactttcgtcaagtgcattttcactcaattccggataatcctcggggat
tttgactacaacgccatcgacaatgccaaccgaatcctgggccctgtgtacttcatcacc
tatgtcttcttcgtcttctttgtgctcctgaacatgttcctggccatcatcaacgacaca
tactcagaggtcaaggaggagctggctggccagagggatcagttgcagctttctgacctc
ctgaaacagagctacagcaagaccctacaaaggctgcgtctgaggaaagagcgggtttca
gatgtgcagaaggtcctgaagggcggggagccagagatccagtttgaagacttcaccaac
accttgagggagctcacaaggagagttctgcagctgcagcgtgttctggaaggagttgtg
tcccaggttgatgccctgagctcaaagctgaagatgctggagaggaaaggggagttggct
ccctccccaggaatggcaagaggagccagctgtttgggagaacccttataa

DBGET integrated database retrieval system