KEGG   Rattus norvegicus (rat): 294232
Entry
294232            CDS       T01003                                 

Gene name
Dhx16, Dbp2, Ddx16
Definition
(RefSeq) DEAH-box helicase 16
  KO
K12813  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    294232 (Dhx16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    294232 (Dhx16)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     294232 (Dhx16)
Spliceosome [BR:rno03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    294232 (Dhx16)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    294232 (Dhx16)
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_30 AAA_22 AAA_19 SecA_DEAD Flavi_DEAD SRP54 T2SSE
Other DBs
NCBI-GeneID: 294232
NCBI-ProteinID: NP_997661
RGD: 1302963
Ensembl: ENSRNOG00000030157
Vega: OTTRNOG00000001534
UniProt: Q6MG13
Position
20p12
AA seq 1044 aa
MATPAGLERWVQEELHSVLGLSERHVAQFLIGTAQRCASAEEFVQRLRDTETLDLGGPAR
DFALKLWSKVPRKAVVEKPARAAEREARALLEKNRSYKLLEDSESGEEAVARDGSSLQKK
RKRRKHLRKKQQEEEEEEEEASESGKRKTGGSKSPTEEKPASEDEWERTERERLQDLEER
DAFAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKR
EREKLEDLEAELADEEVLFGDVELSRHERRELKYKRRVRDLAREYRAAGEQEKLEATNRY
HMPKETRGQPARATDIVEEESGAPGEEQRRWEEARLDAASLKFGARDAAAQEPQYQLVLE
EDETIEFVRAAQLQGDEEPSSGPPLSAQAQQKESIQAVRRSLPVFPFREELLTAIANHQV
LIIEGETGSGKTTQIPQYLFEEGYTKKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEV
GYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIK
DVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVV
SVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQA
RIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKA
SANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMH
FDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCS
EEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQW
CYENFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGDYVRVRKAITSGYFYHTARLTRS
GYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYK
AKELEDPHAKKMPKKVGKTREELG
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggcgacgccggcgggactggagcggtgggtgcaggaggagctgcactcggtgctgggg
ctgagcgagcggcacgtcgcgcagttcctgatcggcacggcgcagcgctgcgcctccgcc
gaggagtttgtgcagcgcttgcgtgacacagagaccctggacctcggcgggccggcgcgg
gacttcgcgctgaagctctggagcaaggtgccacggaaggccgtggttgaaaagccagct
cgtgcagctgagcgagaggcccgagccctgctggagaagaaccgatcttataaattgttg
gaggacagcgagagcggagaggaagcagtggccagggacgggagcagcctccagaagaag
cggaagagacggaaacacctgaggaagaaacagcaggaggaggaggaggaggaggaggaa
gcctctgagtcagggaagaggaagacagggggcagtaaatcacccacggaggagaagcca
gcctcagaggatgagtgggagagaacagaacgtgagcgtctccaggacttggaggaacgg
gatgcctttgcagagcgggttcggcaacgagacaaggaccggacccggaatgttctggag
cggtcagataagaaggcttatgaagaggctcagaagcgcctcaagatggctgaggaagac
cggaaagccatggtccctgagctccgtaagaagtctcgtcgggaatacctggcaaagcgg
gagcgggaaaagctggaggacctggaggcagaactggctgatgaggaggtcctgtttggg
gacgtggagctgagccgccatgagcgccgggagctcaagtacaagcggcgtgtgcgggac
ctggctcgggagtaccgggcggctggcgagcaggagaagctggaggccactaatcgctac
cacatgcccaaggagactcgaggacagcccgctcgagccaccgacatcgtcgaggaggaa
tcaggggccccgggcgaggagcagcggcgctgggaggaggcccgtctggacgccgcatcc
ctcaagtttggggcccgagacgctgctgcccaggaaccccagtaccagctggtgctggag
gaggacgagaccatcgagttcgtccgtgccgctcagctccagggcgacgaggagccgtca
tcaggcccgcccctgtcagcccaggcccagcagaaggagtccatccaggccgtgcgccgc
agcctgccagtgttccccttccgagaggagctcctgaccgccattgccaaccatcaggtc
ctcatcatcgagggcgagactgggtcagggaagaccacacagatcccacagtacctcttt
gaggagggttacaccaagaagggtatgaagattgcttgcacccagccccggagagtggcg
gccatgagtgtggcagcccgagtggcccgggagatgggggtgaagcttgggaatgaggtg
ggctacagcatccggtttgaggactgcacatcagagcgaactgttctccgctacatgaca
gatggaatgctactccgggagttcctctctgagcctgacctcgcaagttacagtgtggtg
atggtggatgaagctcatgagcggaccttgcacacagacattctctttggattgatcaaa
gatgttgctagattccgacctgagctcaaggtcctggtggcttcggccacactggacact
gctcgtttttctgccttcttcgatgatgcccctgtcttccgaatccctggacgcaggttt
ccagttgacatcttctataccaaggccccagaggctgactacctggaagcctgtgtggtg
tctgtgctgcagatccatgtgacccagccccctggggatatactggtgttcctaacggga
caggaggagattgaggctgcctgcgagatgctccaggaccgctgccgcagactgggctcc
aagatccgggagctcctggtgttgcccatttacgccaacctgccctccgacatgcaggct
cgaatcttccagcccacgccccccggggcccggaaggtggttgtggcaacaaacattgca
gaaacttccctcaccatcgaaggcatcatttatgtgctggatccagggttctgcaagcag
aagagctacaaccctcgaacaggcatggagtcgctcaccgtcacaccctgcagcaaggct
tcagccaatcagcgggccggccgcgcaggtcgagtggctgcagggaagtgcttccgcctg
tatacagcctgggcctaccagcatgagctggaggagaccacagttcctgagatccagagg
actagcctgggcaatgtggtgctcctgctaaagagcttagggatccacgacctgatgcac
tttgactttctggacccgccaccatatgagaccctgctgctggctttggaacaactttat
gcacttggcgccctcaaccaccttggagagctcactacgtctggtcgaaagatggcagag
ctgcccgtggatcctatgttgtctaaaatgatcttggcctctgagaagtatagctgttca
gaagagatcctgaccgtggctgctatgctgtctgtcaacaattccatcttctaccggccc
aaggacaaggttgtccatgctgacaacgcccgtgtcaacttcttcctccctggtggggac
cacctggttctgctgaatgtgtacacgcagtgggcagagagcggctactcttcccagtgg
tgctatgaaaatttcgtacagttcagatccatgcgccgagcccgggatgtgcgggaacaa
ctagaggggctcttggagcgcgtggaagttggcttgacttcctgccaaggtgactacgtt
cgtgtgcgaaaggccatcacttcaggttatttttaccacacagcaaggctgactcggagt
ggctaccgcacagtgaagcagcagcagacagtgtttattcatcccaactcctctctcttt
gaacaacagccacgctggctgctctaccatgagcttgtcttgaccaccaaggagttcatg
agacaggtattggagatcgaaagcagctggcttttggaagtggctccccactactataag
gccaaggagctagaagatccccatgctaagaaaatgcccaaaaaagttggcaagacacga
gaagagctgggttag

DBGET integrated database retrieval system