KEGG   Rattus norvegicus (rat): 294269
Entry
294269            CDS       T01003                                 

Gene name
RT1-Da, DA1, H2-Ea, RT1-u
Definition
(RefSeq) RT1 class II, locus Da
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    294269 (RT1-Da)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    294269 (RT1-Da)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    294269 (RT1-Da)
   04612 Antigen processing and presentation
    294269 (RT1-Da)
   04658 Th1 and Th2 cell differentiation
    294269 (RT1-Da)
   04659 Th17 cell differentiation
    294269 (RT1-Da)
   04672 Intestinal immune network for IgA production
    294269 (RT1-Da)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    294269 (RT1-Da)
   05322 Systemic lupus erythematosus
    294269 (RT1-Da)
   05323 Rheumatoid arthritis
    294269 (RT1-Da)
   05320 Autoimmune thyroid disease
    294269 (RT1-Da)
   05321 Inflammatory bowel disease
    294269 (RT1-Da)
   05330 Allograft rejection
    294269 (RT1-Da)
   05332 Graft-versus-host disease
    294269 (RT1-Da)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    294269 (RT1-Da)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    294269 (RT1-Da)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    294269 (RT1-Da)
   05152 Tuberculosis
    294269 (RT1-Da)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    294269 (RT1-Da)
   05164 Influenza A
    294269 (RT1-Da)
   05168 Herpes simplex virus 1 infection
    294269 (RT1-Da)
   05169 Epstein-Barr virus infection
    294269 (RT1-Da)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    294269 (RT1-Da)
   05140 Leishmaniasis
    294269 (RT1-Da)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    294269 (RT1-Da)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   294269 (RT1-Da)
  Exosomal proteins of epithelial cells
   294269 (RT1-Da)
  Exosomal proteins of breast milk
   294269 (RT1-Da)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 294269
NCBI-ProteinID: NP_001008847
RGD: 1593283
Ensembl: ENSRNOG00000032844
Vega: OTTRNOG00000001680
UniProt: Q6MG98
Position
20p12
AA seq 255 aa
MATLGDLVIRFFFMAVLMSPQKSWAIREEHTIIQAEFYLSPDQNGEFMFDFDGDEIFHVD
IKKSETIWRLEEFAQFASFEAQGALANIAVDKANLDIMIKRSNNTPDANVIPEVTVLPKS
PVNLGEPNILICFIDKFSPPAVNVTWLRNGQPVTKGVSETVFLPREDHLFRKFHYLTFLP
STEDYYDCEVDHWGLEEPLRKHWEFEEKTLLPETKENVLCVLGLFVGLVGIVVGIVLIIK
GLRKRNAVERRQGAL
NT seq 768 nt   +upstreamnt  +downstreamnt
atggccacacttggagacctggtgataagatttttcttcatggctgtcctcatgagcccc
cagaagtcgtgggctatcagagaggagcacaccatcatccaggcggagttctatctttcc
cccgaccaaaatggagagttcatgtttgactttgacggtgacgagattttccatgtagat
attaaaaagtcagagaccatctggagacttgaagaatttgcacagtttgccagctttgag
gctcagggtgcattggctaatatagctgtggacaaagctaacctggacatcatgataaag
cgctccaacaacactccagatgccaatgtgattccagaggtgactgtactccccaaaagc
ccggtgaacctgggagagcccaacatcctcatctgtttcattgacaagttctcccctcca
gcggtcaatgtcacctggcttcggaacggacaacctgtcaccaaaggcgtgtcagagacg
gtgtttctcccaagggaggaccacctcttccgcaaattccactatctgaccttcctgccc
tccacggaagattactatgactgtgaggtggatcactggggtctggaggagcctctgcgg
aagcactgggagtttgaagagaaaaccctcctcccagaaactaaagagaatgtcctgtgt
gttctcgggttgtttgtgggtctggtaggcatcgtcgtcgggattgtgctcatcatcaag
ggccttcggaaacgcaacgcagtggaacggcgccaaggagccctgtga

DBGET integrated database retrieval system