KEGG   Rattus norvegicus (rat): 294279
Entry
294279            CDS       T01003                                 

Gene name
Col11a2
Definition
(RefSeq) collagen type XI alpha 2 chain
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    294279 (Col11a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    294279 (Col11a2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   294279 (Col11a2)
SSDB
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Other DBs
NCBI-GeneID: 294279
NCBI-ProteinID: NP_997693
RGD: 2373
Ensembl: ENSRNOG00000000463
Vega: OTTRNOG00000001663
UniProt: Q6MGB2
Position
20p12
AA seq 1617 aa
MERCSRCHRLLLLLPLVLGLSAAPGWAGAPSVDVLRALRFPSLPDGVRKSKGVCPADVAY
RVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRSGLQAPLLTLYSAQGVQQLGLELGRPV
RFLYEDQRGRPQASAQPIFRGLSLADGKWHHVAVAVKGQSVTLIVDCKKRVTRPLPRSVH
PVLDTHGVVIFGAHVLDDEVFEGDVQELLIVPGVQAAYQSCGQKDLECEREQRDGPQTQK
PHRAQRSPKKEPARLHKPQNQEPQQQYPTPGEEEGVLESSLLPSLEEVAHGPRGLKGEKG
EPAVLEPGMFVEGPPGPEGPAGLAGPPGIQGNPGPVGDPGERGPPGRAGLPGSDGPPGPP
GTSLMLPFRFGSSGGDKGPVVAAQEAQAQAILQQARLALRGPPGPMGYTGRPGPLGQPGS
PGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRAGADGARGMPGEPGVKGDRGFDGLPGL
PGEKGQRGDTGAQGLPGPPGEDGERGDDGEIGPRGLPGESGPRGLLGPKGPPGIPGPPGP
QGEPGPPGQQGTPGTQGLPGPQGAIGPHGEKGPRGKPGLPGMPGSDGLPGHPGKEGPPGT
KGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGV
PGSRGEDGPEGPKGRTGPTGDPGPTGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGA
SGEKGARGLSGKSGPRGERGPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGP
QGPNGFPGPKGPPGPAGKDGLPGHPGQRGEVGFQGKTGPPGPPGVVGPQGAAGESGPMGE
RGHPGPPGPPGEQGLPGTAGKDGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGPGL
KGNEGPAGPPGPAGSPGERGAAGSGGPIGPPGRPGPQGPPGAAGEKGVPGEKGPIGPTGR
DGVQGPVGLPGPAGPPGVAGEDGDKGEVGDPGQKGTKGNKGEHGPPGPPGPIGPVGQPGA
AGADGEPGARGPQGHFGAKGDEGTRGFNGPPGPIGLQGLPGPFGEKGETGDVGPMGPPGP
PGPRGPAGPNGADGPQGPPGGVGNLGPPGEKGEPGESGSPGVQGEPGVKGPRGERGEKGE
SGQAGEAGPPGPKGPTGDDGPKGNPGPVGFPGDPGPPGEAGPRGQDGAKGSQGEDGEPGQ
PGSPGPTGENGPPGPLGKRGDPGAVGAPGKTGPVGPAGPAGKPGPDGLRGLPGSVGQQGR
PGATGQAGPPGPVGPPGLPGLRGDAGAKGEKGHPGLIGLIGPTGEQGEKGDRGLPGPQGS
PGQKGETGIPGASGPIGPGGPPGLPGPSGPKGAKGATGPAGPKGEKGVQGPPGHPGPPGE
VIQPLPIQMPKKTRRSVDGSKLMQDEEATPTGGAPGSPAGLEEIFGSLDSLREEIEQMRR
PTGTQDSPARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDV
TQFSYVDSEGSPVGVVQLTFLRLLSVSAHQDVSYPCSGVSQDGPLKLRGANEDELSPETS
PYVKEFRDGCQTQQGRTVLEVRTPVLEQLPVLDASFSDLGAPTRRGGVLLGPVCFMG
NT seq 4854 nt   +upstreamnt  +downstreamnt
atggagcggtgcagccgctgccaccgcctcctactgctcctacctctggtgctgggtctg
agtgctgccccaggatgggcaggtgcaccctctgtggatgtgctacgtgccctgaggttc
ccctcccttcccgatggtgttcggaaatcaaaaggggtctgtccagctgatgtggcttac
cgtgtggcacgacctgcccagctcagcgcacccacacgccagctcttcccaggaggcttt
cccaaagatttctctctgctgactgttgtccggacccgctctggcctccaagctcccctc
ctgactctatacagtgcccagggagtccagcaactgggcctggagctcggtcgtccagtc
cgctttctctatgaggaccagaggggacggccacaagcctccgctcagcccatcttccga
ggcctgagcctcgctgatggcaagtggcaccatgtggctgtagctgtgaagggtcagtct
gtcactctcattgtggactgtaagaagcgagtcacccggccccttccccgaagcgtgcat
ccggtgctggacacccacggggtggtgatctttggtgcccacgtcctcgatgatgaagtc
tttgaaggtgatgttcaggaactcctcattgtcccgggcgtccaagctgcctatcagtct
tgtggacagaaggacctggaatgcgagagagaacagagggacgggcctcagactcagaag
cctcacagggcccagagatctccaaagaaggagccagccagacttcataagccacagaac
caggagccccagcagcagtaccccaccccaggtgaagaggaaggagtcctggagtccagc
ctcttgccatctcttgaagaggttgcccacggaccccgggggctaaagggagagaaggga
gagcctgcagtgctggagcctggtatgtttgtagagggacctccaggcccagaaggccca
gcggggttagctggaccccctggcatccaggggaacccaggcccagttggagaccctggc
gagaggggcccccctggccgggcagggctccctggatcagacggacctcctggtcctcct
ggtacatctctgatgctcccattccggtttggcagcagtggtggtgacaagggccccgtg
gtggcagcccaggaggcccaggcccaggcaattctgcagcaggcacggctggccctccgt
gggccccctggccccatgggatacacgggccgtcctggaccgttgggtcagcctgggagc
cctggcttgaagggagaatctggagacctgggcccacagggccccagaggacctcagggc
ctcacaggtcctcctggcaaggctgggcgaaggggccgagcaggtgctgatggagcccgt
gggatgcccggagaacctggcgtgaagggtgaccgaggctttgacggactgcctgggcta
cctggtgaaaagggacaaaggggtgacacaggtgctcagggccttcctgggcctcccggt
gaggacggagagaggggtgacgatggagagattgggccccgcgggctgcctggagagtca
ggacctagaggactccttggccctaaaggccctcctggtattcctgggcccccgggacct
caaggagagccagggcctcccggacaacagggcactcctggaactcagggcctccccgga
cctcagggtgccattggacctcatggagagaagggccctcgtgggaaaccaggcctccct
ggcatgccgggatcagatggactcccgggccacccagggaaggaaggaccccctggaacc
aaagggaaccagggcccctccggacctcagggtcctttaggatacccaggccctcgaggc
gtcaagggcgtggatgggattcggggcctgaagggccacaagggtgaaaagggtgaggac
ggctttcctggattcaaaggtgacataggtgtgaaaggagacaggggcgaggtcggagtc
cctggttccaggggagaagatggccccgaagggccgaaagggcgcactggacctaccgga
gaccccgggcccacggggctcatgggcgagaagggcaagctaggtgttcctggtctgcct
ggctaccccggacgccagggtcccaagggatctctgggttttcctggttttcctggagcc
agtggagagaagggagctcggggcctgtctgggaaatcaggacctcggggagaacggggc
cccacgggtccaaggggtcagcggggacctcgaggtgccactgggaagtctggagctaag
ggaacatcaggtggtgatggtcctcacgggccgcccggagagaggggtcttcctggaccg
caaggccccaatggattccctggccccaaaggccctccgggccccgcagggaaagacggg
ctgccgggacacccaggccagagaggagaagtgggattccaagggaagaccggcccccca
ggcccgcccggagtggtgggacctcagggagcagctggggaaagcggccccatgggggag
agaggtcaccctggccccccaggacctcctggagagcaagggctgcccggaactgctgga
aaagatgggaccaagggtgaccccgggccccccggggccccagggaaggatggccccgct
ggtctgagaggcttcccaggagagcgaggcctcccgggcactgctggcggacctggcttg
aagggaaatgaaggcccagctggccctcctggccctgcaggctctcctggcgagcgaggt
gcagcaggatcagggggccccattggtccccctggacgtccaggcccacagggtccccct
ggggcagcaggagagaaaggcgtgccgggtgagaaaggccctattggtcccacgggtcgt
gacggggtgcagggccctgtggggcttcctggtcccgcgggacccccaggcgtggcagga
gaggatggagacaagggtgaggtgggcgaccctgggcagaagggaaccaaaggaaacaag
ggtgagcatggccctcctggccctcctggtcccatcggtcctgtggggcagcctggagct
gcgggagctgacggcgagcccggagcccgcggaccccagggacactttggagccaaaggt
gacgaaggaacaagagggttcaatgggccccctggacccatcggcctacagggcctgcca
ggaccttttggggaaaagggagaaacaggagacgtggggcctatgggaccccctggcccc
ccaggacctcgaggccccgctggacccaatggtgctgatggcccacaaggtccccctgga
ggtgtcggaaacttgggtccccctggagagaagggtgaaccaggggagtcggggtctcca
ggagtccagggtgagccgggcgtcaagggtccacgtggagagcgtggtgagaaaggagag
tctgggcaggcaggagaggctggaccaccagggcccaaaggccctacaggcgatgacggc
cccaaggggaaccctggtcccgttggctttcctggggaccctggcccccccggagaagct
ggcccaaggggccaggatggtgctaagggaagccaaggcgaggatggcgagccgggacag
cctggatcccccggccccaccggggagaacgggccccctggacctcttggaaagcggggg
gaccctggtgctgtgggggccccaggaaagacgggccctgtgggccctgcaggcccagca
gggaagcctggccccgatggtcttcgagggctccctggctcagtgggtcagcaaggccgc
cctggagccacaggccaggctgggcccccaggtcctgtgggacccccagggcttcctggc
ctccggggtgatgctggcgccaagggggagaagggtcatccaggcctcatcggactgatt
gggccgaccggagagcaaggcgagaagggtgaccgtggccttcctggccctcagggctca
cctggacaaaagggagagacgggtatcccaggagcatctggtcctatcggtcctggagga
cctcctggcctgcctggaccgtccggccccaaaggagctaaaggagccacaggccccgct
ggacccaaaggagagaaaggtgttcagggccctccaggacacccgggtcccccgggcgag
gtgatccagccactgcccatccagatgcccaagaagacccggcgctctgtggacggaagc
aaactgatgcaggatgaggaggccacacccactggcggtgccccgggcagtcctgcagga
ctggaggagatcttcggttcactggactctctgcgggaggagatcgaacagatgaggagg
ccgacagggacccaggacagccctgcccgcacctgccaggacttgaagctgtgccaccca
gagcttcccgatggagagtactgggttgaccccaaccagggctgtgcccgggacgccttc
cgggtgttctgcaactttacagcaggaggggagacttgtgtcacacccagggatgacgtc
acacagttctcctacgtggactctgaaggctccccagtgggcgtggtccagctcaccttc
ctgcggctgctcagcgtctctgcccaccaggatgtttcctacccttgctctggggtatcc
caggacggtcccctgaaactccgaggggccaatgaggatgagctgagccctgagaccagc
ccttacgtcaaggagttcagagatggctgtcagacccagcaaggccggacggtgttagag
gtgcgcacgcctgtgctggagcagctgcccgtgctggatgcttccttctcagacctgggg
gcccctacaagacggggaggggtgcttctggggcctgtctgcttcatgggctag

DBGET integrated database retrieval system