KEGG   Rattus norvegicus (rat): 29430
Entry
29430             CDS       T01003                                 

Gene name
Hap1
Definition
(RefSeq) huntingtin-associated protein 1 isoform B
  KO
K04647  huntingtin-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04727  GABAergic synapse
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    29430 (Hap1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29430 (Hap1)
   05016 Huntington disease
    29430 (Hap1)
   05022 Pathways of neurodegeneration - multiple diseases
    29430 (Hap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29430 (Hap1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    29430 (Hap1)
SSDB
Motif
Pfam: HAP1_N
Other DBs
NCBI-GeneID: 29430
NCBI-ProteinID: NP_817091
RGD: 68327
Ensembl: ENSRNOG00000014819
UniProt: P54256
Position
10
AA seq 629 aa
MRPKEQVQSSAGDGTGSGDPATGTPTTQPAADPAPEPSAEPKPAPAQGTGSGQKSGSRTK
TGGSFCRSRIRGDSDAPWTRYIFQGPYGPRATGLGTGRAEGIWKTPAAYIGRRPGVSGPE
RAAFIRELQEALCPNPLPRKKITEDDIKVMLYLLEEKERDLNTAARIGQSLVKQNSVLME
ENNKLETMLGSAREEILHLRKQVNLRDDLLQLYSDSDDDEEDEEDEEEEEGEEEEREGQR
DQDQQHDHPYGAPKPPPKAETLHHCPQLEALKQKLKLLEEENDHLREEASHLDNLEDKEQ
MLILECVEQFSEASQQMAELSEVLVLRLEGYERQQKEITQLQAEITKLQQRCQSYGAQTE
KLQQQLASEKGVHPESLRAGSHMQDYGSRPRERQEDGKSHRQRSSMPAGSVTHYGYSVPL
DALPSFPETLAEELRTSLRKFITDPAYFMERCDTRCREERKKEQGTMPPPPVQDLKPPED
FEAPEELVPEEELGAIEEVGTAEDGPAEETEQASEETEAWEEVEPEVDEATRMNVVVSAL
EASGLGPSHLDMKYVLQQLSNWQDAHSKRQQKQKVVPKDSPAPQQQTNMGGGIVEQQPIV
PTQDSQRLEEDRATHSPSAREEEGPSGAT
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgcgcccgaaggagcaggtgcagagcagtgccggggacgggacggggtcgggggaccca
gcaacaggcacccccacgacccagcctgcagcggatcccgctccggagccctcggcagag
cccaaacctgctccggcgcagggaaccgggtccggacagaaatcaggatcccgaaccaag
acaggaggaagcttttgtaggtccaggatccgtggcgactcggacgcaccatggacccgc
tacatattccaggggccttacggtccccgggctactggcctgggcactggaagggctgag
ggaatctggaagacgccagccgcgtacatcggccgaaggcccggcgtgtccggccctgag
cgcgcggcgtttattcgagagctgcaggaagcgctgtgtcctaatccactgcccaggaag
aagatcaccgaagatgatatcaaagtgatgttgtatttgctggaagagaaagaacgggac
ctgaacacagccgctcgcatcggccagtccctggtgaaacagaatagtgttctgatggag
gagaataacaagctggaaaccatgctgggctcagccagagaggagattttacatctccgg
aagcaggtgaacctgcgagatgatctccttcagctctactcggactccgatgacgatgag
gaggatgaagaggatgaggaagaggaagagggagaagaggaggaacgagaaggacagagg
gaccaagatcagcagcacgaccatccctatggtgcccccaagccgccccctaaggctgag
acgctgcaccactgcccacagctggaagccctgaagcagaagctgaaactgctggaagaa
gagaacgaccatcttcgagaggaggcctcccaccttgacaacctggaagacaaagaacag
atgctcattctggagtgtgtggaacagttttctgaagccagccagcagatggcagagcta
tccgaggtgttggtgctgaggctggaaggctatgagaggcagcagaaggagatcactcag
ctgcaggccgagatcaccaagctacaacagcgttgtcagtcttatggggcccagacggag
aaactgcagcagcagctggcctcagagaagggagtccacccagagagcctgcgagctggc
tcccacatgcaggattatggaagcaggcctcgtgaacgccaggaggatgggaagagccat
cgtcagcgttcctcaatgcctgcaggttctgtcacccactatggatacagtgtgcctctg
gatgcacttccaagtttcccagagacactggcggaggagctccggacatccctgaggaag
ttcatcactgaccctgcgtatttcatggagagatgtgacactcgctgcagagaggaacga
aagaaggagcaggggacaatgccacccccaccggtgcaagatctcaagccgcctgaagat
ttcgaggctccagaggagctggttcctgaggaggagctgggggccatagaagaggtgggg
acagctgaggatgggccggcagaagagacagagcaggcatctgaggagaccgaggcctgg
gaggaggtggaaccggaggtggacgaggccacaaggatgaatgtggtggtctctgccctg
gaggccagcggcctgggcccttcacacctggacatgaagtatgtcctccagcaactgtcc
aactggcaggacgcccattctaagcggcagcagaagcagaaggtggtcccgaaagactcc
ccagccccgcagcagcaaacaaacatggggggcgggatcgtggagcagcagcccatagtg
ccgacccaggactctcagaggctggaggaggacagggccactcactctcccagtgccagg
gaggaagaggggccttctggggccacctag

DBGET integrated database retrieval system