KEGG   Rattus norvegicus (rat): 29452
Entry
29452             CDS       T01003                                 

Gene name
Epas1
Definition
(RefSeq) endothelial PAS domain-containing protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29452 (Epas1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    29452 (Epas1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29452 (Epas1)
   04131 Membrane trafficking [BR:rno04131]
    29452 (Epas1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    29452 (Epas1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    29452 (Epas1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1 HIF-1a_CTAD PAS PAS_9 PAS_4 Corona_I HLH
Other DBs
NCBI-GeneID: 29452
NCBI-ProteinID: NP_075578
RGD: 68404
Ensembl: ENSRNOG00000021318
UniProt: Q9JHS1
Position
6
AA seq 874 aa
MTADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLTLKTGSGFGKKNKDRSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRILELVGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVVYNPRNLQPQCIMCVNYVLSEIEKNDVVVSMDQTE
SCSSHTLMAMNSIFDTSDDVALSEKSNYLFTNLKEEPEDLAQLAPTPGDAIISLDFGSQN
FDESSTYGKAILPPGQPWATELRSHSAQSESRSLPAFTVPQAGSPGNATPSATSSSSCST
PSSPEDYYSSLENHLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQ
LSPICPEEPLVPESPQPNPQHCFSTMSSIFQPLTPGASQGTFFLDKYPQQLESRKTESEH
WPMSTIFFDAGSKGSLPPCCGQASTPLSSMGGRSNTPWPPDPPLHLGPTKWSVGNQSAEP
LGPLPLGTSQLEPPSTPPHVSMFKMRSAKDFGARGPYMMSPAMIALSNKLKLKRQLDYEE
PAFQDTSGGDPPGTSSSHLMWKRMKSLMGGTCPLMPDKTVSASMAPDEFTQKSMRGLGQP
LRHLPPSQPPSTRSPGENAKSGFPPQCYASPFQDYSPPGAQKGSGVASRLLGPSFEPYLL
PELTRYDCEVNVPEPGSSTLLQGRDLLRALDQAT
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgacagctgacaaggagaagaaaaggagcagctcggagctgaggaaggagaaatcccga
gatgccgcacggtgccggcgtagcaaggagacggaggtcttctatgaactggctcatgag
ctgccgctgccccacagtgtgagctcccacctggacaaagcctccatcatgcgcctggcc
atcagcttcctgcgaacacataaactcctgtcttcagtgtgctctgaaaatgaatctgaa
gccgaggctgaccagcagatggataacttgtacctgaaagccttggagggcttcattgcc
gtggtgacccaagacggtgatatgatctttctgtcagaaaacatcagcaagttcatggga
cttacccaggtagaactaacaggacacagcatctttgacttcactcatccttgcgaccac
gaggagatccgagagaacctgacactcaaaactggctctggttttgggaagaagaacaaa
gataggtctaccgagcgtgacttcttcatgaggatgaagtgtaccgtcaccaacagaggc
cggactgtcaaccttaagtcggccacctggaaggtcttgcactgcaccgggcaagtgaga
gtctacaacaactgcccccctcacagtagcctctgcggctacaaggagcccctgctgtcc
tgcctcatcatcatgtgtgagccaatccagcacccatcccacatggacatccccttggac
agcaagactttcctaagccgccacagcatggacatgaagttcacctactgtgatgacaga
atcttggaactggttggttaccaccccgaggagctacttggccgctctgcctatgaattc
taccacgccctggactcggagaacatgacaaaaagtcaccagaacttgtgcaccaagggg
caagtggtgtctggccagtaccggatgctggccaaacatggaggatatgtgtggttggag
acccaggggaccgtcgtctacaacccccgcaacctgcagccccagtgtatcatgtgtgtc
aactatgtcctgagtgagatagagaagaatgacgtggtggtctccatggaccagactgaa
tcttgttcaagccacaccctgatggccatgaacagcatctttgacacaagtgacgacgtg
gccctatccgagaagagcaactacctgttcaccaacctgaaggaggagccagaggacctg
gcccagctggcccccaccccaggggatgctattatttctctggacttcggaagccagaac
tttgatgaatcctcgacttatggcaaggccatccttcccccaggccagccgtgggccaca
gagctgaggagccacagtgcccagagtgagtccaggagcctgccagccttcaccgtgccc
caggcaggttccccagggaatgccacacccagcgccacaagcagcagcagctgctccacg
cccagcagccctgaggattactactcatctctggagaatcacttgaagatcgaagtaatc
gagaagctcttcgccatggacaccgaggcgaaggatcagtgcagtactcagacggacttc
aatgaactggacttggagaccctggcaccctacatccctatggatggcgaggacttccag
ctcagccccatctgcccggaggagccactcgtgccggagagcccccagcccaacccccag
cactgtttcagtaccatgtcaagcatcttccagccgctcaccccgggggccagccaaggc
accttcttccttgacaagtacccgcagcagttggaaagccggaagacggagtccgagcac
tggcccatgtctaccatcttctttgatgctgggagcaaagggtccctgcccccatgctgt
ggccaggccagcacccctctctcctctatggggggcagatctaacacgccttggccccca
gatccaccattacatttaggccctacgaagtggtctgtgggcaatcagagcgctgaaccc
ctggggcctctgccactggggacctcgcagttggagcctcccagcaccccgcctcatgtc
tccatgttcaagatgaggtctgcaaaggactttggggctcgaggcccatacatgatgagc
ccggccatgatagccctgtccaacaagctgaagctaaagcgccagctggactacgaggag
ccagccttccaagacacaagtgggggggaccctccaggcaccagcagttcacacttgatg
tggaaacgaatgaagagcctcatgggcgggacctgtcctttgatgcctgacaagaccgtc
agtgcaagcatggctcctgatgaattcacccaaaaatccatgagaggcctgggccagcca
ctgagacacctgccaccttcccagccaccatctaccaggagtccaggagagaacgccaag
agtgggttcccaccacagtgctatgcctccccgttccaggactacagtcctccaggagct
caaaaggggtcaggagtggcaagtcgactgctggggccatcgttcgagccttacctgctg
ccggaactgaccagatatgactgtgaggtgaacgtgcccgagcctggaagttctacactc
ctgcaggggagagaccttctcagagctctggaccaggccacctga

KEGG   Rattus norvegicus (rat): 29560
Entry
29560             CDS       T01003                                 

Gene name
Hif1a
Definition
(RefSeq) hypoxia-inducible factor 1-alpha
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04659  Th17 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05211  Renal cell carcinoma
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    29560 (Hif1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    29560 (Hif1a)
   04137 Mitophagy - animal
    29560 (Hif1a)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    29560 (Hif1a)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    29560 (Hif1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29560 (Hif1a)
   05205 Proteoglycans in cancer
    29560 (Hif1a)
   05230 Central carbon metabolism in cancer
    29560 (Hif1a)
   05231 Choline metabolism in cancer
    29560 (Hif1a)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29560 (Hif1a)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    29560 (Hif1a)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    29560 (Hif1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29560 (Hif1a)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    29560 (Hif1a)
SSDB
Motif
Pfam: PAS_3 HIF-1a_CTAD PAS_11 PAS HIF-1 PAS_9 PAS_4 DDRGK HLH
Other DBs
NCBI-GeneID: 29560
NCBI-ProteinID: NP_077335
RGD: 61928
Ensembl: ENSRNOG00000008292
UniProt: O35800
Position
6
AA seq 823 aa
MEGAGGENEKKNRMSSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASV
MRLTISYLRVRKLLGAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKY
MGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVRKGKEQNTQRSFFLRMKCTLTSRG
RTMNIKSATWKVLHCTGHIHVYDTSSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDS
KTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQ
VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTES
VLKPVESSDMKMTQLFTKVESEDTSCLFDKLKKEPDALTLLAPAAGDTIISLDFGSDDTE
TEDQQLEDVPLYNDVMFPSSNEKLNINLAMSPLPASETPKPLRSSADPALNQEVALKLES
SPESLGLSFTMPQIQDQPASPSDGSTRQSSPEPNSPSEYCFDVDSDMVNVFKLELVEKLF
AEDTEAKNPFSAQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSVSTVTGFQ
QTQLQKPTITVTATATATTDESKAVTKDNIEDIKILIASPPSTQVPQEMTTAKASAYSGT
HSRTASPDRAGKRVIEKTDKAHPRSLNLSVTLNQRNTVPEEELNPKTIALQNAQRKRKME
HDGSLFQAAGIGTLLQQPGDRAPTMSLSWKRVKGYISSEQDGMEQKTIFLIPSDLACRLL
GQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
NT seq 2472 nt   +upstreamnt  +downstreamnt
atggagggcgccggcggcgagaacgagaagaaaaataggatgagttccgaacgtcgaaaa
gaaaagtctagggatgcagcacgatctcggcgaagcaaagagtctgaagttttttatgag
cttgctcatcagttgccacttccccacaacgtgagctcccatcttgataaagcttctgtt
atgaggctcaccatcagttacttacgtgtgaggaaacttctaggtgctggtgatcttgac
attgaagatgaaatgaaagcacagatgaactgcttttatctgaaagccctggatggcttt
gttatggtgctaacagatgatggtgacatgatttacatttctgataacgtgaacaaatac
atggggttgactcagtttgaactaactggacacagtgtgtttgattttacccatccatgt
gaccatgaggaaatgagagaaatgcttacacacagaaatggcccagtgagaaaggggaaa
gaacaaaacacgcagcgaagcttttttctcagaatgaaatgtaccctaacaagccggggg
aggacgatgaacatcaagtcagcaacgtggaaggtgctgcactgcacaggccacattcat
gtgtatgataccagcagtaaccagccgcagtgtggctacaagaaaccgcctatgacgtgc
ttggtgctgatttgtgaacccattcctcatccatcaaacattgaaattcctttagacagc
aagacatttctcagtcgacacagcctcgatatgaaattttcttactgtgatgaaaggatt
actgagttgatgggttatgagccagaagaacttttgggccgttcaatttatgaatattat
catgctttggactctgatcatctgaccaaaactcatcatgacatgtttactaaaggacaa
gtcaccacaggacagtacaggatgcttgcaaaaagaggtggatatgtctgggttgagact
caagcaactgttatatataatacgaagaactctcagccacagtgcattgtgtgtgtgaat
tatgttgtaagtggtattattcagcacgacttgattttctcccttcaacaaacagaatct
gtcctcaaaccagttgaatcttcagatatgaaaatgacccagctgttcactaaagtggaa
tctgaggacacgagctgcctcttcgacaagcttaagaaagagcccgatgccctgactctg
ctagctccagcggctggggacacgatcatatcactggacttcggcagcgatgacacggaa
actgaagaccaacaacttgaagatgtcccgttgtacaatgatgtaatgttcccctcttct
aatgagaaattaaatataaatctggcaatgtctccattacctgcctctgaaactccaaag
ccacttcgaagtagtgctgatcctgcactgaatcaagaggttgcattgaagttagagtca
agcccagagtcactgggactttcttttaccatgccccagattcaagatcagccagcaagt
ccttctgatggaagcactagacaaagctcacctgagcctaacagtcccagtgagtactgc
tttgatgtggacagcgatatggtcaatgtattcaagttggaactggtggaaaaactgttt
gctgaagacacagaagcgaagaatccattttcagctcaggacactgatttagacttggaa
atgctggctccctatatcccaatggatgatgatttccagttacgttcctttgatcagttg
tcaccattagagagcaattctccaagccctccgagtgtgagcacagttacaggattccag
cagacccagttacagaaacctaccatcactgtcactgccaccgcaactgccaccactgat
gaatcaaaagcagtgacgaaggacaatatagaagacattaaaatactgattgcatctcca
ccttctacccaagtacctcaagaaatgaccactgctaaggcatcagcatacagtggtact
cacagtcggacagcctcaccagacagagcaggaaagagagtcatagaaaaaacagacaaa
gctcatccaaggagccttaacctatctgtcactttgaatcaaagaaatactgttcctgaa
gaagaattaaacccaaagacaatagctttgcagaatgctcagaggaagcgaaaaatggaa
catgatggctccctttttcaagcagcaggaattggaacgttactgcagcaaccaggtgac
cgtgcccctactatgtcgctttcttggaaacgagtgaaaggatacatatctagtgaacag
gatggaatggagcagaagacaatttttttaataccctctgatttagcatgtagactgctg
gggcagtcaatggatgagagtggattaccacagctgaccagttacgattgtgaagttaat
gctcccatacaaggcagcagaaacctactgcagggtgaagaattactcagagctttggat
caagttaactga

DBGET integrated database retrieval system