KEGG   Rattus norvegicus (rat): 29467
Entry
29467             CDS       T01003                                 

Gene name
Ddit3
Definition
(RefSeq) DNA damage-inducible transcript 3 protein
  KO
K04452  DNA damage-inducible transcript 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05202  Transcriptional misregulation in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29467 (Ddit3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29467 (Ddit3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    29467 (Ddit3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    29467 (Ddit3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29467 (Ddit3)
   05012 Parkinson disease
    29467 (Ddit3)
   05014 Amyotrophic lateral sclerosis
    29467 (Ddit3)
   05020 Prion disease
    29467 (Ddit3)
   05022 Pathways of neurodegeneration - multiple diseases
    29467 (Ddit3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29467 (Ddit3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    29467 (Ddit3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29467 (Ddit3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    29467 (Ddit3)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 GAS DivIC Fungal_TACC DUF5595 Gcd10p DASH_Hsk3 TraH_2 DASH_Spc19 WDCP RR_TM4-6 bZIP_Maf Phlebovirus_NSM
Other DBs
NCBI-GeneID: 29467
NCBI-ProteinID: NP_001103456
RGD: 62391
Ensembl: ENSRNOG00000006789
UniProt: Q496Y7
Position
7
AA seq 168 aa
MAAESLPFAFETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPAEVTSTSQSPRSPDSSQSSMAQEEEEEDQGRTRKRKQSGQCAARAGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcagctgagtctctgcctttcgcctttgagacagtgtccagctgggagctggaagcc
tggtatgaggatctgcaggaggtcctgtcctcagatgaaattgggggcacctatatctca
tccccaggaaacgaagaggaagaatcaaaaaccttcactactcttgaccctgcatcccta
gcttggctgactgaggagccagggccagcagaggtcacaagcacctcccaaagccctcgc
tctccagattccagtcagagttctatggctcaggaggaagaagaggaagatcaaggaaga
actaggaaacggaaacagagtggtcagtgcgcagcccgggctgggaaacagcgcatgaag
gagaaggagcaggagaatgagaggaaagtggcacagcttgctgaagagaacgagcggctc
aagcaggaaatcgagcgcctgaccagggaggtagagaccacacggcgggctctgatcgac
cgcatggtcagtctgcaccaagcatga

DBGET integrated database retrieval system