KEGG   Rattus norvegicus (rat): 29468
Entry
29468             CDS       T01003                                 

Gene name
Pdia3
Definition
(RefSeq) protein disulfide-isomerase A3 precursor
  KO
K08056  protein disulfide-isomerase A3 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04612  Antigen processing and presentation
rno05163  Human cytomegalovirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29468 (Pdia3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    29468 (Pdia3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29468 (Pdia3)
   05168 Herpes simplex virus 1 infection
    29468 (Pdia3)
   05163 Human cytomegalovirus infection
    29468 (Pdia3)
   05169 Epstein-Barr virus infection
    29468 (Pdia3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    29468 (Pdia3)
   04131 Membrane trafficking [BR:rno04131]
    29468 (Pdia3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29468 (Pdia3)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     29468 (Pdia3)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Protein disulfide isomerase
   29468 (Pdia3)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    29468 (Pdia3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   29468 (Pdia3)
  Exosomal proteins of colorectal cancer cells
   29468 (Pdia3)
  Exosomal proteins of bladder cancer cells
   29468 (Pdia3)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA OST3_OST6 Thioredoxin_3
Other DBs
NCBI-GeneID: 29468
NCBI-ProteinID: NP_059015
RGD: 68430
Ensembl: ENSRNOG00000015018
UniProt: P11598
Position
3
AA seq 510 aa
MRFSCLALLPGVALLLASALLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAP
WCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAY
DGPRTADGIVSHLKKQAGPASVPLRTEDEFKKFISDKDASVVGFFRDLFSDGHSEFLKAA
SNLRDNYRFAHTNVESLVKEYDDNGEGITIFRPLHLANKFEDKIVAYTEKKMTSGKIKKF
IQESIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNTKGSNYWRNRVMMVAKTFLDAGH
KLNFAVASRKTFSHELSDFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQE
YFDGNLKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPK
YKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELND
FISYLQREATNPPIIQEEKPKKKKKAQEDL
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgcgcttcagctgccttgcgctgctcccgggcgtggcgttgctgctcgcctcggccctc
ctcgcctccgccctcctcgcctccgcctcagacgtgttggaactgacggacgaaaacttc
gagagtcgcgtctccgacacgggctcagctgggctcatgctagtcgagttcttcgcccca
tggtgtggacattgcaagaggcttgcccctgagtatgaagctgcagcaaccagattaaaa
ggaatagtcccattagcaaaggtggactgcactgccaacacaaacacctgtaataagtat
ggcgtcagcggctacccaactcttaaaatatttagagatggtgaagaagcgggtgcttat
gatgggcctaggactgccgatggaattgtcagccacttgaagaaacaagcaggaccagct
tcagttcctctcaggactgaggacgaatttaagaagttcattagtgataaagatgcctcg
gtggtgggctttttcagggatttattcagtgatggccactccgagttcctaaaagcagcc
agcaacttgagagataactaccgatttgcacacaccaacgttgaatctctggtgaaggag
tacgatgataatggagaggggattactatatttcgtccattacatctggctaacaaattt
gaagacaaaattgtggcatatactgaaaagaaaatgaccagtggcaaaatcaagaagttt
attcaggaaagcatttttggtctctgtcctcatatgacagaagataataaagatttgata
caaggcaaggacttactcacggcttactatgatgtggactatgaaaagaatactaaaggt
tctaactactggagaaacagggtcatgatggtggcaaagacattccttgatgctggacac
aaactcaactttgctgtagctagccgtaaaacctttagccatgaattgtctgactttggc
ttagaaagcactactggagagattcctgttgtggctatcagaactgctaaaggagagaag
tttgtcatgcaggaggagttctcgcgggatggcaaggctcttgagcggttcctgcaggaa
tactttgatggcaacttgaagagatacctgaagtctgaacctatccccgagaccaacgaa
ggacctgtcaaggtggtggtagcagagagttttgatgacatagtgaatgctgaagacaag
gacgtgctgatcgagttttatgctccttggtgtggccactgtaagaacctggaacccaag
tacaaagagctgggggagaaactcagcaaagacccaaatattgtcatagccaagatggat
gccacagccaatgatgtgccttctccatatgaagtcaagggttttcctaccatctacttc
tcaccagccaacaagaagctaactccaaagaagtatgaaggtggccgtgaattaaatgat
tttatcagctatctacaacgagaagctacaaaccctcctataattcaagaagaaaaacct
aagaagaagaagaaggcacaagaggacctctaa

DBGET integrated database retrieval system