KEGG   Rattus norvegicus (rat): 294797Help
Entry
294797            CDS       T01003                                 

Gene name
Il7r
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04630  Jak-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno05200  Pathways in cancer
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    294797 (Il7r)
   04068 FoxO signaling pathway
    294797 (Il7r)
   04151 PI3K-Akt signaling pathway
    294797 (Il7r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    294797 (Il7r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    294797 (Il7r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    294797 (Il7r)
  09163 Immune disease
   05340 Primary immunodeficiency
    294797 (Il7r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    294797 (Il7r)
   04090 CD molecules [BR:rno04090]
    294797 (Il7r)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL2 receptor family
   294797 (Il7r)
CD molecules [BR:rno04090]
 Proteins
  294797 (Il7r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FN3_7 fn3
Motif
Other DBs
NCBI-GeneID: 294797
NCBI-ProteinID: NP_001099888
RGD: 1309776
Ensembl: ENSRNOG00000017413 ENSRNOG00000058446
UniProt: D4A3X8
Position
2q16
AA seq 457 aa AA seqDB search
MMALGRAFAIVFCLLQAASGESGNAQDGDLEDAEPDDHSFWCHSQLEVDGNQHSLTCAFN
DPDIKTTNLEFQICGALLGIDCLTLNKLREMYFIKTSKFLLIGNSSVCVKLGKMDVICKI
LDISTIVKPEAPSNLKVVYRKEANDFLVTFNTSHSTKKYVTALKHDVAYRPERGESNWTH
VYLFHTRTTILQRKLQPKAVYEIKVRSIPNHEYFKGFWSEWSPSSTFETPDSKYQGGWDP
VLPSIILLSLFSMVLLVILAHVLWKKRIKPVVWPSLPDHKKTLEQLCKKPKKNLNVSFNP
ESFLDCQIHEVNGIQARDEVESFLQNDLPPRPGELEKQGHRATVHGANWPSEISGSTPET
FRRESPLRCLARNLSTCNTPAFLSSRSPDYREGDGNRSHVYQDLLPSSRNTNGTVPQPFP
LQSGILIPVSQGQPISTSSVLNQEEAYVTMSSFYQNK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgatggctctgggtagagctttcgctatagttttctgcttacttcaagctgcttctgga
gaaagtggcaatgcccaggatggagatctagaggatgcggaaccagatgatcactccttc
tggtgccacagccagctggaagtggatggaaatcagcactcactgacgtgtgcttttaat
gacccagacatcaaaaccactaatctggaatttcaaatatgtggggctcttctaggcata
gattgcctaactcttaataagctacgagagatgtattttataaagacatcaaaattctta
ctgattggtaacagcagtgtatgtgtgaagcttggaaaaatggatgtaatttgcaaaatt
ttggacataagcacaatagttaaacctgaggcgccttctaacctgaaagtagtttatcga
aaagaagcaaatgactttttggtaacatttaatacatctcactcaacaaagaaatatgta
acagcattaaagcatgatgtggcctaccgcccagaaaggggtgaaagtaactggacgcat
gtatatttattccatacaagaacaacaatcctacagagaaaactacaaccaaaagcagtg
tatgaaatcaaagtccgatccattcccaatcatgaatacttcaaaggcttctggagtgag
tggagtccaagttctacctttgaaacaccagattccaagtatcaagggggatgggatccg
gttttgccaagtatcatccttctgagtttgttctctatggttttgttggtcattttagcc
catgtgctatggaaaaaaaggattaaacctgttgtatggcctagtcttcctgatcataag
aaaactctggaacaactatgtaagaagccaaaaaagaatttgaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatgaggtgaatggcattcaagccagggatgaagtg
gaaagctttctgcaaaatgatcttcctccacggcctggggagctggagaagcagggacat
agagcaactgtacacggtgcaaactggccatctgagatttcaggcagcacaccagaaacg
ttccgaagagaatcacccctaagatgcctggctagaaatctaagcacatgcaatacccct
gcattcctttcctctaggtcccctgactacagagaaggtgacggaaataggtctcatgtg
tatcaagacttgctgccaagctccagaaacacaaatggcactgtccctcaaccatttcct
ctccagtcaggaatcctgataccagtttctcaaggacagcccatctctacttcttcagta
ttgaatcaagaagaagcatatgtcactatgtctagcttttaccaaaacaaatga

DBGET integrated database retrieval system