KEGG   Rattus norvegicus (rat): 29489
Entry
29489             CDS       T01003                                 

Gene name
Dync1h1, Dnch1, Dnchc1
Definition
(RefSeq) dynein cytoplasmic 1 heavy chain 1
  KO
K10413  dynein heavy chain 1, cytosolic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29489 (Dync1h1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    29489 (Dync1h1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29489 (Dync1h1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29489 (Dync1h1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29489 (Dync1h1)
   04147 Exosome [BR:rno04147]
    29489 (Dync1h1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      29489 (Dync1h1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     29489 (Dync1h1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   29489 (Dync1h1)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_7 AAA_lid_11 MT AAA_5 Dynein_heavy Dynein_AAA_lid AAA AAA_22 AAA_33 AAA_18 Mg_chelatase T2SSE AAA_19 AAA_lid_1 AAA_25 IstB_IS21
Other DBs
NCBI-GeneID: 29489
NCBI-ProteinID: NP_062099
RGD: 2511
Ensembl: ENSRNOG00000006178
UniProt: P38650 M0R9X8
Position
6q32
AA seq 4644 aa
MSETGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGDAPAALEAALEEKSAL
EQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIKRA
PVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSV
EKKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKPKVTDFGDKVEDPTFL
NQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLD
ILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFT
HLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQT
WDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVR
VLRPQVTAVAQQNQGEAPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEG
TEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIR
EYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYM
KRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIES
ARVRGRSGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLI
ESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFN
FQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNK
LDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHEL
RITNQVIYLNPPIEECRYKLYQEMFAWKMIVLSLPRIQSQRYQVGVHYELTEEEKFYRNA
LTRMPDGPVALEESYSAVMGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLSKWQAL
LVQIRRARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMTEF
HSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQRF
QFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTDWE
KTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQVA
LEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPARLRQYAS
YEFVQRLLKGYMKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKN
EAIVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKVKEHIN
SVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHLLP
VETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLERE
RSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDSSVVLGISSREGE
EVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYITWI
DKYQAQLVVLSAQIAWSENVENALSNVGGGGDVGPLQSVLSNVEVTLNVLADSVLMEQPP
LRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQMA
NAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALGHQ
LGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQCIQEAL
REHSNPNYDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFRSLAMT
KPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSAGN
VKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLS
DVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINHGLMM
VGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDGLFTH
VLRKIIDNVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRIM
FEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRRKGKE
DEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFKLEHIMDLTRLRCLGSLFSML
HQACRNVAQYNANHPDFPMQIEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYIRRIT
TVPLPTAPNIPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVRHEALLY
TWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYR
RTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTWVK
LERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLIPSL
RTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPVEGLI
RIWAHEALRLFQDRLVEDEERRWTDENIDMVALKHFPNIDKEKAMSRPILYSNWLSKDYI
PVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSGAG
KTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESNVLDS
GFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIRNL
HVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNYIV
PDYMPVVYDKLPQPPTHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLDFINH
YANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKLKK
MVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAVKSIKKQ
HLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDA
IREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDD
AKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSL
SAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQ
FRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMN
EYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTGGRVLI
TLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAERP
DVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEVTR
KVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQVHFLYQYSLQFFLDIYHNVLYE
NPNLKGATDHTQRLSVITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTMGEPTYD
AEFQHFLRGKEIVLSAGSTPKVQGLTVEQAEAVARLSCLPAFKDLIAKVQADEQFGIWLE
SSSPEQTVPYLWTEETPATPIGQAIHRLLLIQAFRPDRLLAMAHMFVSTNLGESFMSIME
QPLDLTHIVGTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGFNQADK
AINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLRAG
RIFVFEPPPGVKANMLRTFSSIPVSRMCKSPNERARLYFLLAWFHAVIQERLRYAPLGWS
KKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVDNEFDQ
RLLNTFLERLFTTRSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDAQTPSWLG
LPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHT
TASNWLHLIPQTLSPLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKK
KQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISQAAAAGGAK
ELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTASQSTTLDACSFGVTG
LKLQGATCSNNKLSLSNAISTVLPLTQLRWGKQTSAEKKASVVTLPVYLNFTRADLIFTV
DFEIATKEDPRSFYERGVAVLCTE
NT seq 13935 nt   +upstreamnt  +downstreamnt
atgtcggagaccggcggcggtgaggacggctcggccggcctggaggtgtccgcggtgcag
aatgtggcggacgtgtcggtgctgcagaagcaccttcgtaagctggttccgctgctgctg
gaggacggcggcgacgcgccggctgcgctggaggcggcgctggaggagaagagcgccctg
gagcagatgcgcaagttcctgtcagacccgcaggtccacacggtcctggtggagcgctcc
accctcaaagaggacgttggtgatgaaggagaagaggagaaagaattcatttcctataac
atcaacatagacattcattacggggtgaagtccaatagcttggcgttcatcaagcgagcc
cctgtgattgatgcagacaagccggtgtcttcccagctccgagtcctcacgctgagcgaa
gactcgccctacgagaccctgcactccttcatcagcaatgcagtggctcctttctttaag
tcctacatcagagagtctggcaaagcagacagggatggagataagatggctccttcggtt
gagaaaaagattgcagagcttgagatggggctccttcacctgcagcagaacattgagatc
ccggagatcagcttgccaatccaccccattatcaccaacgtcgctaagcagtgctacgag
cgtggagaaaagcccaaagttacagatttcggtgataaggttgaagacccaacctttctt
aaccagttacagtctggagttaatcggtggatccgagaaattcaaaaggtgaccaagctt
gaccgagatccagcatcaggaactgccttgcaggaaatcagcttttggctaaacttggag
cgtgcattgtaccgcatccaggagaagcgggagagcccagaggtgctcctgactctggac
atcttgaagcatggcaaacgtttccatgccactgtcagttttgacacagacacaggtctt
aagcaggcgttggaaacggtgaatgactacaatcctctgatgaaagacttccccctgaat
gacttgctgtctgccactgagctggacaagataaggcaggcacttgttgcaattttcaca
catctgagaaagatccgaaacacaaaataccccattcagcgggccctgcgacttgtggag
gcaatttccagagacttgagttctcagttgctcaaagtcttgggcacgaggaagttgatg
catgtagcgtatgaagagtttgaaaaggtcatggtggcttgcttcgaagtcttccagacg
tgggatgatgagtatgagaaactccaagtgctgctgagggacatcgtcaagaggaagagg
gaggagaacctgaagatggtgtggcgcatcaaccctgctcacaggaagctgcaggcccgc
ctggaccagatgaggaagttccgccgccagcacgagcagctgagagctgtcattgtcaga
gtcctgcgcccacaggtcacagcagttgcacagcagaaccaaggagaggcacctgaaccc
caagacatgaaagtggccgaggtcctctttgatgctgcagatgccaacgccatcgaggag
gtgaacctggcctatgagaacgtcaaggaagtagatgggctggatgtttccaaagaaggg
acggaggcttgggaggctgcaatgaagagatacgatgagaggatcgaccgcgtggagacc
cgcatcactgcccgcctccgagatcagctcggcacagccaagaatgccaatgagatgttc
aggattttctccaggttcaacgcactgttcgtccgcccacacatccgaggggccattcgt
gaataccagacccagctgatccagcgtgtaaaagatgacattgagtctctgcacgacaag
tttaaggtccagtacccacaaagccaagcttgtaaaatgagtcatgtccgcgacttgccc
cctgtgtcagggtctatcatctgggctaaacagattgaccgacagctcactgcctacatg
aagcgagtggaagacgtcctgggcaagggttgggagaaccacgtggaagggcagaagctg
aagcaggatggtgacagctttcgaatgaagctcaacacccaggaaatcttcgatgactgg
gcgaggaaggttcagcaacgcaaccttggtgtttccgggcgcatcttcaccattgagagc
gctcgcgtgcggggccgctctggaaacgtcctcaagctaaaggtgaacttccttccagag
atcataacactctccaaagaagtccggaacctcaagtggcttggcttccgcgtgccactt
gcaattgtgaacaaggctcaccaagccaaccagctctacccatttgccatctcgctgatt
gaaagcgtccgcacttacgaacgtacctgtgagaaggtggaggagcgcaataccatttca
ctgctagtggccggcctgaagaaggaggtgcaagccttgatcgcagaaggcatcgcgttg
gtgtgggagtcctacaaactcgacccctatgtgcagcgcctggcagagacggttttcaac
ttccaagagaaggtggacgacctcctgattatcgaggagaagatagacctggaagtccgt
tccttggaaacctgcatgtatgatcacaagacattctctgaaatcttgaacagagtgcag
aaagcagtggacgacctcaacctgcactcctactccaacctgcccatctgggtcaacaag
ctggacatggagattgaaaggatactgggtgtccgcctgcaagctggccttcgagcttgg
acccaggttctcctcggacaagctgaagataaagcagaggtagacatggacaccgatgct
ccacaagttagtcacaagcctggtggagagcccaagatcaaaaacgttgttcatgagcta
agaataacaaatcaggtaatctatttgaatccacccatcgaagagtgcaggtacaagcta
taccaggagatgtttgcttggaagatgattgtgctgtccctgcccaggatccagagtcag
aggtaccaggtgggagtgcattatgagttgaccgaggaagagaagttctatcggaatgcc
ttgacacgcatgcctgacggccctgtcgcactggaagagtcctactcggcggtcatgggc
attgtgactgaagtcgagcagtatgttaaggtttggcttcagtaccagtgtctgtgggac
atgcaggcagagaacatttacaacaggctgggggaggacctcagcaagtggcaagcgctc
ctggtgcagatcaggagagcccgagggaccttcgacaatgccgagaccaagaaggagttt
ggaccagtggtgatagattacggcaaggtccagtccaaggtgaacttgaagtatgactcc
tggcataaggaggttctcagcaaatttgggcagatgctgggctcaaacatgacagaattc
cattcccagatctcaaagtctcgccaagagctggagcagcactccgttgacacagccagc
acctctgacgcggtgaccttcatcacctatgtgcagtctctgaaacggaagatcaagcag
ttcgagaagcaagttgaactctaccgcaatggtcagcgtctgctggaaaaacaaaggttc
cagttcccaccttcttggctttacattgacaacatcgagggtgagtggggggccttcaat
gacatcatgcgtcggaaggactctgccattcagcaacaggttgcaaacctgcaaatgaag
atcgtgcaggaggaccgagctgtggaaagccggactaccgatctgttgacagactgggag
aagaccaaacctgtcacaggcaacctacgtcctgaggaggctcttcaggccctcaccatc
tatgaagggaagttcggccgactgaaggatgacagggagaagtgtgccaaggccaaggag
gcactggagctcacagacacggggctcctcagcggcagtgaagaacgagtccaggtggcc
ttggaggagttacaagacctcaagggggtgtggtcagagctttctaaggtctgggaacaa
attgatcaaatgaaggagcagccatgggtctcagttcagcctcgtaagcttcgacaaaac
ctagacggcctcctgaaccagctgaagaacttccctgcaaggcttcggcagtacgcctcc
tatgagtttgttcagaggctgctgaaaggctacatgaagataaacatgttggtaattgaa
ttgaaatcggaagcacttaaagaccggcactggaagcagctgatgaagaggcttcacgtt
aattgggtggtttctgagctgaccctgggccagatctgggatgttgaccttcagaagaac
gaagccattgtcaaggatgtgctgctagtggcacaaggagagatggctttggaagaattt
ttgaagcagatacgggaagtgtggaacacatacgaactagacttggtcaactatcagaac
aagtgccgtctgatccgaggctgggatgacctcttcaacaaggtcaaggagcacatcaac
agcgtctctgccatgaagctctctccgtattacaaggtgtttgaagaagatgccctgagc
tgggaggacaagctgaaccgaatcatggctctctttgacgtgtggattgatgtgcagagg
cgctgggtctacttggaaggcatcttcacaggcagtgcagacatcaaacatctgctgcct
gtggaaacccagcgctttcagagtatcagcacggagtttttggctctgatgaaaaaggtc
tccaagtctccacttgtgatggatgttctgaacatacagggagtccagaggtctctggaa
aggttggccgacctgcttggaaagatccagaaagcattaggggagtacctggaacgagag
cgctcatctttccccaggttctactttgtgggtgatgaggatttgcttgaaatcattgga
aatagcaagaatgtggctaagttgcagaagcacttcaagaaaatgttcgctggcgtttcc
agcatcatcttaaatgaggacagctctgtggtcctcggcatttcctcccgagaaggggag
gaggttatgtttaaaactccagtgtccatcactgaacaccccaaaatcaacgagtggctc
actctggtggaaaaggagatgagagtcaccttggccaaacttctggcagaatctgtaaca
gaagtggagatttttggaaaagcaacttctattgacccaaatacctacattacttggatt
gataaataccaggcccagctagtggttttgtcggcccagatagcctggtctgagaacgtg
gagaatgcactaagcaacgtcggaggaggcggagacgtggggcccttgcagtctgtgctc
agcaacgtggaggtcacactcaacgtcttagcagattctgtcctcatggagcagccccct
ctccggagaaggaaactggagcacttgatcacagagttggttcaccaaagagatgttacc
aggtccttgatcaaaagcaagattgacaacgccaaatctttcgaatggctcagccagatg
cgattttactttgaccctaagcaaacggacgtgttacagcagctgtccatccagatggca
aatgccaagtttaactacggctttgagtacctgggcgttcaagacaagctggttcagacg
cccctcacggaccgctgctacttgacaatgacacaggctctggaggccaggctcgggggc
tccccgttcggaccggctggaacaggaaagacggagtctgtcaaagccctcggccatcag
ctggggcgattcgtcttagttttcaactgtgacgaaacctttgatttccaggcgatggga
cggatcttcgtggggctttgccaagtgggcgcgtggggctgcttcgatgagtttaaccgg
ctggaggagcggatgctgtccgctgtgtcccagcaggtgcagtgcatacaagaggcactg
cgggagcactccaaccccaactacgacaagacctcagcccccattacttgtgagctgctg
aacaaacaagtcaaggttagcccagatatggctatcttcatcaccatgaatccaggctac
gcaggccgctcaaacctccctgacaacctcaagaagctcttccggagcctggcgatgacc
aagcctgaccggcagctgatcgcccaggtcatgctgtactcacagggcttccggactgct
gaggtccttgccaacaaaatcgtcccgttctttaaactgtgtgacgagcagctgtcttct
caaagccattatgactttggtctgcgggctttgaagagcgtgctcgtgagtgcaggcaac
gtgaagagggagaggatccagaagataaagagggagaaagaagagcgaggggaagccgtc
gatgaaggagagatcgctgagaacctgcctgagcaggagattctgatccagagtgtctgc
gagacgatggtgcccaagctcgtggcggaagacatcccgctgctcttcagtctcctgtca
gacgtgttccctggggtgcagtaccaccgtggggagatgacagcccttcgagaagagctg
aagaaagtgtgtcaggagatgtacttgacgtatggtgatggagaagaagttggcgggatg
tgggttgaaaaggttctccagctctatcagatcacccagattaaccatggcctgatgatg
gttgggccttcaggaagcgggaagagcatggcctggcgtgtgctgctgaaagctcttgag
aggctcgagggtgtggagggtgtggcccacataattgaccccaaggccatcagcaaagac
cacctctacggaaccttggatcccaacaccagggagtggacagacggactcttcacacat
gtgctgagaaagatcatagacaatgtgagaggcgagctgcagaagcgccagtggattgtc
ttcgatggtgatgtggaccccgagtgggtggagaacctcaactccgtgctcgacgacaac
aagctcttgacattgcccaatggagagcgtcttagcctgccacccaatgtgcgaataatg
tttgaggtgcaggacttgaagtatgcaaccctggccaccgtgtctcgctgcggcatggtg
tggttcagtgaggacgtgctgagcacggacatgatcttcaacaacttcctggccaggctg
cgcagcattcccctggatgagggggaggatgaggcacagcgaaggcgcaaaggcaaagaa
gacgagggtgaagaggccgcctctccaatgctgcagattcaaagagatgcagcaacgatc
atgcagccatacttcacgtccaatggcctggtcaccaaggcgctggagcatgccttcaag
ctggagcacatcatggacctgacccgcctgcgctgcctgggctcactcttctccatgctg
caccaggcctgccgcaatgtggcccagtacaatgccaaccatcctgatttccccatgcag
attgagcagctggagcgctacattcagcgctatctggtgtatgccatcctctggtcctta
tctggagacagccggctgaaaatgagagcagagctgggcgagtacatcagaaggatcacc
actgtgcctctgcccaccgcgcccaacatccccatcattgactatgaggtgtccatcagt
ggagaatggtcaccgtggcaggccaaggtgcctcagattgaagtggagacacacaaggta
gcagccccagatgtcgtcgtgccaaccctagatacagtccgccatgaagctctcttgtac
acctggctggctgagcacaaacccctggtcttatgcggccctcctgggtctggcaagacc
atgacactcttcagcgccctccgagccttgcctgacatggaggttgtgggcctgaacttc
tcaagtgccactacaccagagctgttgctgaagacgtttgaccactactgcgaataccgg
cgcacccctaacggtgttgtcttggctcctgttcagcttggaaagtggctagtcctgttt
tgtgatgaaatcaacttgccagatatggataagtacggtacccagagagtcatctccttc
atcagacagatggtggagcatggaggcttctatcgtacctcagaccaaacatgggtgaag
ctagagagaatccagtttgttggagcttgcaatccgcccactgaccctgggagaaagccc
ctctcacataggttcttgcgccacgtgcctgttgtgtatgtggattacccaggaccagcc
tccctgacgcagatctatggcaccttcaaccgcgccatgctgagactcattccctcgctc
cgcacctatgcagaacccctcaccgcagccatggtggagttctataccatgtcccaggag
agatttactcaggacacacagccacactatatctattcaccccgtgagatgactcggtgg
gtaagaggaatctttgaagcactgagacccctggagacattgcctgttgaaggtctcatt
cgcatttgggcacatgaagccctccgtctcttccaagacaggcttgtggaggatgaagag
cggcgctggactgatgagaacatcgacatggttgccttgaagcatttccctaacatagac
aaagagaaagccatgagccggcctatcctgtacagcaactggctgtcaaaggactatatc
ccagttgaccaagaggagctaagggattatgtcaaggctaggctgaaggtcttctatgaa
gaagagcttgacgttcccctggtcttgttcaatgaagtgctggaccatgtgctcaggatt
gacaggatattccgacaacctcaaggccacttgcttctcattggtgttagtggagctgga
aagaccaccctgtctcggtttgtcgcctggatgaatggcttgagtgtctatcagattaag
gtccacaggaaatacactggggaagactttgatgaagacctcaggacagtgctgcgacgc
tcgggctgcaaaaatgagaagatagcattcataatggatgaatccaatgtcttagactct
gggttcctggaacgaatgaatactctgctggccaacggcgaggttcctgggctctttgaa
ggggacgagtatgccacgttgatgactcagtgcaaagagggagcacagaaggagggcctc
atgctggactcacatgaggagctctacaagtggttcaccagccaggtgatccgcaacctg
cacgtggtgttcaccatgaacccgtcctcagaggggctcaaggacagggcggccacgtca
ccagcccttttcaacaggtgtgtgctgaactggtttggtgactggtccacagaagcactc
tatcaagttggcaaagaattcaccagtaaaatggacctggagaagccaaactatatagtg
cctgactacatgccagttgtgtacgataaacttccacagcccccaacacaccgggaagcc
attgtgaacagctgtgtgtttgttcatcagactcttcaccaggctaacgcacgcctggca
aagcgaggcggcagaacaatggccatcacacctcggcactacctggacttcatcaaccac
tacgccaacctcttccatgagaagcgcagcgagttggaggagcagcagatgcacctgaac
gttgggctccgaaaaatcaaagagactgtggaccaggtggaagaactgcgccgtgacctg
aggatcaagagccaagagctggaggtcaagaacgcagcagccaatgacaagctgaagaaa
atggtgaaagaccagcaagaggctgagaagaaaaaggtcatgagccaagaaattcaggag
cagctgcacaagcagcaggaagtgattgcagataagcagatgagtgtcaaggaggatctg
gataaagtagagcctgctgtcatcgaggcccagaatgctgtgaagtccatcaagaagcag
cacctggtggaggtaaggtccatggccaaccctccagctgccgtgaagctggctctggag
tccatctgcctgctgcttggtgagagcaccacggactggaagcagatccgctccatcatc
atgagagagaacttcatccccaccatcgtcaacttctcagccgaggagatcagtgacgcc
ataagagagaagatgaagaaaaactacatgtccaaccccagttacaactacgaaatcgtc
aaccgggcttctctggcttgcggccctatggtgaagtgggcaattgcacagctcaattat
gcagacatgttaaagcgagtggagcccctgcggaatgagctgcagaagctggaagatgat
gccaaggacaaccagcagaaagccaatgaggtggagcagatgatccgggatctggaagcc
agcatcgcccgctacaaggaggagtatgctgtcctcatctcggaggcccaggccatcaag
gcagacctggcagctgtcgaagcgaaagtaaaccgaagcactgcacttctaaagagttta
tctgctgaaagggaacgttgggaaaagacaagtgaaacgttcaaaaaccagatgtctacc
attgctggggactgcctcctgtcggcggccttcattgcttatgcaggctactttgaccag
cagatgcgccagaacttgttcaccacctggtctcatcacttacagcaagccaacatccag
ttccgcacagacattgccaggacggagtacctctccaatgctgacgagcgcctccgctgg
caggccagctccctgcctgctgacgacctgtgcacagaaaacgccatcatgctaaagcgg
ttcaataggtacccgttgatcattgacccctccggacaggccacagaattcatcatgaat
gagtataaggaccggaagatcacaaggaccagcttcttagacgatgccttccggaagaat
ttggagagtgctctgagatttggcaatccccttctcgtccaggatgtggagagctacgat
ccagttttgaatccagtactgaaccgtgaagtccggcgaacaggagggagagtgctgatt
accctcggtgaccaagacattgacctgtcaccatcctttgtcatctttctgtctacccga
gacccaactgtggagttcccaccagatctctgttcccgggtgaccttcgtgaacttcacg
gtcacccgcagcagtttacagagccagtgtctcaatgaagttcttaaagcagaaaggccc
gatgtggatgagaagcgttctgacctcttgaagctgcaaggggagttccagctccgttta
cggcaactggaaaagtctctgctccaagctctgaacgaggtaaaaggccgcattctggat
gacgacaccatcattacaaccctggaaaatctgaagcgggaagccgccgaggtcaccaga
aaggtggaggagacggacattgtcatgcaggaggtagagaccgtgtcccagcagtacctg
ccgctgtccactgcatgcagcagcatctacttcactatggagtccctgaagcaggttcac
ttcctgtatcagtactcactgcagttcttcctggacatctaccacaatgtgctctatgag
aaccccaacctgaagggcgccaccgatcacacacagcgcctctctgtcatcaccaaggac
ctcttccaggtggcctttaaccgggtggcccgaggcatgctgcaccaggaccacatcacc
ttcgccatgctgctggcgaggatcaagctgaaaggcaccatgggggagcccacctatgac
gcagagttccagcacttcctccgagggaaggagatcgtgctgagtgctggctccaccccc
aaagtccagggcctgactgtggagcaggcggaagctgtggcaaggttgagctgtctgcct
gcctttaaagatctcattgccaaggttcaggcagatgagcagtttggcatttggctggag
agcagttcaccagagcagacagtgccatacctctggactgaggagacgcctgcaactccc
atcgggcaggccatccaccgcctactcctgattcaagctttccgacccgaccgcctgctg
gccatggcccacatgtttgtttccacaaacctcggagagtccttcatgtccatcatggag
cagccacttgacctcacccacattgtgggcacagaggtgaagccaaacacacctgtcctg
atgtgctctgtgcctgggtatgatgccagcggacatgtcgaggacctcgccgcagagcag
aacacacagatcacttctattgccattggctcagcagaaggctttaaccaagcagataag
gcgatcaacaccgcggtgaagtcaggcaggtgggtgatgctgaagaatgtgcacctggcc
cccgggtggctgatgcagctggaaaagaagcttcactccctgcagccacacgcctgcttc
cgactcttcctcaccatggagatcaaccccaaggtgcccgtgaacctgctccgtgcaggt
cggatctttgtgtttgagccgccacctggcgtgaaggccaacatgctgaggaccttcagc
agcatccccgtctccaggatgtgcaagtctccaaatgagcgagcccgcttgtacttcctg
ctggcctggttccatgctgtcatccaagagcgcctgcgctatgctccactcgggtggtcc
aagaaatacgaatttggagaatctgaccttcgatcggcttgtgacacggtggacacatgg
ttggatgacacagccaagggccgacagaacatctcaccagataagatcccatggtctgcc
ctgaagacattgatggcccagtccatctatggtgggcgggtggacaatgagtttgaccag
cgtctgctcaataccttcctggagcgcctgtttaccacccggagtttcgatagtgaattc
aagctggcgtgcaaggtcgatgggcacaaggacattcagatgcctgacggtatcaggcga
gaggagtttgtgcagtgggtggagctgctgcctgacgcccagacaccctcatggctgggc
ctccccaacaatgctgaaagggtcctgcttaccacccaaggcgtggacatgatcagcaag
atgctgaagatgcagatgctggaggacgaggacgacctggcctacgcagagacggagaag
aagacaaggacggactccacctcagacggccgtccagcctggatgagaacactgcacacg
acggcctcaaactggctgcacctcatcccacagacactgagcccactgaagcgcacggtg
gagaacatcaaggaccctttgtttaggttcttcgagagagaggtgaagatgggggccaag
ttactgcaagatgtgcgccaagaccttgctgacgtcgtccaagtgtgcgaggggaaaaag
aagcagacaaactacctgcgcacgctcatcaatgagctggtgaaagggatcttgccccgg
agctggtcccattacacagtacctgcaggcatgacggtgatccagtgggtgtcagatttc
agcgagaggatcaaacagctgcagaatatctcacaggctgctgcagccgggggtgccaag
gaactgaagaacatccacgtgtgcctgggtggcctgtttgtgcctgaggcctacatcact
gccaccagacagtatgtggcacaagccaacagctggtccctggaggagctctgcctcgaa
gtcaatgtcaccgcctcccagagtaccacccttgatgcgtgcagctttggggtcacaggt
ctgaagctccaaggggccacgtgcagcaacaacaaactctcgctgtccaatgcgatctcc
acagtcctccccctcacacagctacgctgggggaagcaaactagtgctgagaagaaggcc
agtgtggtgactttacctgtctatctgaacttcacgcgggcagacctcatcttcactgta
gactttgaaattgctacaaaggaagatcctcgaagcttctatgagcgtggagttgcagtt
ctgtgcactgagtaa

DBGET integrated database retrieval system