KEGG   Rattus norvegicus (rat): 294930Help
Entry
294930            CDS       T01003                                 

Gene name
Nceh1, Aadacl1, RGD1311104
Definition
(RefSeq) neutral cholesterol ester hydrolase 1
  KO
K14349  neutral cholesterol ester hydrolase 1 [EC:3.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
rno04976  Bile secretion
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    294930 (Nceh1)
  09154 Digestive system
   04976 Bile secretion
    294930 (Nceh1)
   04979 Cholesterol metabolism
    294930 (Nceh1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    294930 (Nceh1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    294930 (Nceh1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     294930 (Nceh1)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   294930 (Nceh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_3 COesterase Say1_Mug180 Peptidase_S9 Esterase_phd AXE1
Motif
Other DBs
NCBI-GeneID: 294930
NCBI-ProteinID: NP_001120996
RGD: 1311104
Ensembl: ENSRNOG00000013313
Vega: OTTRNOG00000002255
UniProt: B2GV54
Position
2q24
AA seq 408 aa AA seqDB search
MRSSCVLLAALLALVAYYVYIPLPSAVSDPWKLMLLDATFRGAQQVSNLIHSLGLSHHLI
TLNFIIISFGKKSARSSPRVKVTDTDFDGVEVRVFEGPPKPDEPLRRSVVYIHGGGWALA
SAKISYYDQLCTAMAEELNAVIVSIEYRLVPQVYFPEQIHDVIRATKYFLQPEVLDKYKV
DPGRVGVSGDSAGGNLAAALGQQFTYVESLKNKLKLQALIYPVLQALDFNTPSYQQSMNT
PILPRHVMVRYWVDYFKGNYDFVEAMIVNNHTSLDVERAAALRARLDWTSLLPSSIKKNY
KPVLQTIGDARIVKEIPQLLDAAASPLIAEQEVLQALPKTYILTCEHDVLRDDGIMYAKR
LESAGVNVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRDSYFKWLDQNL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgtcatgcgtcctactggccgcgctgctggcgctagtcgcctactacgtgtac
atcccactgcccagcgctgtgtccgacccctggaaactgatgctgctggatgccactttc
cgcggcgcgcagcaagtgagtaacctgatacattccctgggactgagccaccatctgatc
acactgaatttcatcatcatctcttttggcaagaaaagcgcaaggtcttctccaagagtg
aaggtgacggacactgacttcgatggcgtggaggtccgagtattcgaaggccctccaaaa
ccagatgagccgctgcgccgcagtgtggtctatatccacggaggaggctgggccttggcc
agtgcaaaaatcagctactatgaccagctgtgcacagcaatggccgaggagctgaacgcc
gtcatcgtttctattgaatacaggctagttccacaggtttattttcctgagcaaattcat
gatgtcatccgggccaccaaatacttcctacagccagaagtcttagacaagtacaaggtg
gaccctggaagagtcggcgtttctggagacagtgccggtgggaatttggctgcagccctt
ggacagcagtttacctacgttgaaagcctgaagaataagctcaaactacaggctttgatc
tacccggtcctgcaggctttggacttcaacacaccctcttatcagcagagcatgaatact
cccatcctgcctcgccacgtcatggtgaggtactgggtagactacttcaagggcaactat
gactttgtagaggcaatgattgtgaacaatcacacttcacttgatgtagaaagggctgca
gccctcagggcccgtctggactggacatccctgttgccctcatccatcaaaaagaactac
aagcctgtcttacagaccataggggacgccagaatcgtcaaggagatcccccagctgctg
gacgccgctgcttccccgctcatcgcagagcaggaagtgcttcaggccctcccgaagacc
tacatcctcacgtgcgagcatgatgtcctgcgtgacgacgggatcatgtacgccaagcgc
ctggagagtgcgggtgtgaacgtgaccttggaccactttgaggacggcttccatggctgt
atgattttcacaagctggccgaccaacttctctgtaggaatccggactagggatagttac
ttcaaatggctggatcaaaacctgtga

DBGET integrated database retrieval system