KEGG   Rattus norvegicus (rat): 29495
Entry
29495             CDS       T01003                                 

Gene name
Dlg4
Definition
(RefSeq) disks large homolog 4
  KO
K11828  discs large protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04724  Glutamatergic synapse
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    29495 (Dlg4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29495 (Dlg4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    29495 (Dlg4)
   05022 Pathways of neurodegeneration - multiple diseases
    29495 (Dlg4)
  09165 Substance dependence
   05030 Cocaine addiction
    29495 (Dlg4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29495 (Dlg4)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Others
    29495 (Dlg4)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    29495 (Dlg4)
SSDB
Motif
Pfam: Guanylate_kin PDZ PDZ_assoc PDZ_6 PDZ_2 MAGUK_N_PEST SH3_1 SH3_2 DUF6288 SH3_9
Other DBs
NCBI-GeneID: 29495
NCBI-ProteinID: NP_062567
RGD: 68424
Ensembl: ENSRNOG00000018526
UniProt: P31016
Structure
PDB: 

Position
10
AA seq 724 aa
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGE
MEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFV
NEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGN
QHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVY
LKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKD
LLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL
SVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT
ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDS
ETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIIL
GPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIE
AGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLE
INKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPA
RERL
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggactgtctctgtatagtgacaaccaagaaataccgctaccaagatgaagacacgccc
cctctggaacacagcccggcccacctccccaaccaggccaattctccccctgtgattgtc
aacacggacaccctagaagccccaggatatgagttgcaggtgaatggaacagagggggag
atggagtatgaggagatcacattggaaaggggtaactcaggtctgggcttcagcatcgca
ggtggcactgacaacccgcacatcggtgacgacccgtccatttttatcaccaagatcatt
cctggtggggctgcagcccaggatggccgcctcagggtcaatgacagcatcctgtttgta
aatgaagtggatgttcgggaggtgacccattcagctgcggtggaggccctcaaagaggca
ggttccatcgttcgcctctatgtcatgcgccggaaacccccagccgaaaaggtcatggag
atcaaactcatcaaagggcctaaaggacttggcttcagcattgcggggggcgttgggaac
cagcacatccctggagataacagcatctatgtaacaaagatcatcgaaggaggtgctgcc
cacaaggatggcaggttgcagattggagacaagatcctggcggtcaacagtgtggggctg
gaggacgtcatgcacgaggatgccgtggcagccctgaagaacacatatgacgttgtgtac
ctaaaggtggccaagcccagcaatgcctacctgagtgacagctatgctcccccagacatc
acaacctcgtattctcagcacctggacaatgagatcagtcatagcagctacttgggcact
gactaccccacagccatgacccccacttcccctcggcgctactcccctgtggccaaggac
ctgctgggggaggaagacattccccgggaaccaaggcggatcgtgatccatcggggctcc
accggcctgggcttcaacattgtgggcggcgaggatggtgaaggcatcttcatctccttc
atccttgctgggggtccagccgacctcagtggggagctacggaagggggaccagatcctg
tcggtcaatggtgttgacctccgcaatgccagtcacgaacaggctgccattgccctgaag
aatgcgggtcagacggtcacgatcatcgctcagtataaaccagaagagtatagtcgattc
gaggccaagatccatgatcttcgggaacagctcatgaatagtagcctaggctcagggact
gcatccttgcgaagcaaccccaagaggggcttctacattagggccctgtttgattacgac
aagaccaaggactgcggtttcttgagccaggccctgagcttccgcttcggggatgtgctt
catgtcattgacgctggtgacgaagagtggtggcaagcacggcgggtccactccgacagt
gagaccgacgacattggcttcattcccagcaaacggcgggtcgagcgacgagagtggtca
aggttaaaggccaaggactggggctccagctctggatcacagggtcgagaagactcggtt
ctgagctatgagacggtgacccagatggaagtgcactatgctcgtcccatcatcatcctt
ggacccaccaaagaccgtgccaacgatgatcttctctccgagttccccgacaagtttgga
tcctgtgtccctcatacgacacgtcctaagcgggaatatgagatagacggccgggattac
cactttgtctcctcccgggagaaaatggagaaggacatccaggcacacaagttcattgag
gctggccagtacaacagccacctctatgggaccagcgtccagtctgtgcgagaggtagca
gagcaggggaagcactgcatcctcgatgtctcggccaatgccgtgcggcggctgcaggcg
gcccacctgcaccccatcgccatcttcatccgtccccgctccctggagaatgtgctagag
atcaataagcggatcacagaggagcaagcccggaaagccttcgacagagccacgaagctg
gagcaggagttcacagagtgcttctcagccatcgtagagggcgacagctttgaagagatc
tatcacaaagtgaaacgtgtcattgaagacctctcaggcccctacatctgggtcccagcc
cgagagagactctga

DBGET integrated database retrieval system