KEGG   Rattus norvegicus (rat): 294962
Entry
294962            CDS       T01003                                 

Gene name
Gnb4
Definition
(RefSeq) G protein subunit beta 4
  KO
K04538  guanine nucleotide-binding protein subunit beta-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04926  Relaxin signaling pathway
rno05032  Morphine addiction
rno05034  Alcoholism
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    294962 (Gnb4)
   04371 Apelin signaling pathway
    294962 (Gnb4)
   04151 PI3K-Akt signaling pathway
    294962 (Gnb4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    294962 (Gnb4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    294962 (Gnb4)
  09156 Nervous system
   04724 Glutamatergic synapse
    294962 (Gnb4)
   04727 GABAergic synapse
    294962 (Gnb4)
   04725 Cholinergic synapse
    294962 (Gnb4)
   04728 Dopaminergic synapse
    294962 (Gnb4)
   04726 Serotonergic synapse
    294962 (Gnb4)
   04723 Retrograde endocannabinoid signaling
    294962 (Gnb4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    294962 (Gnb4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    294962 (Gnb4)
  09165 Substance dependence
   05032 Morphine addiction
    294962 (Gnb4)
   05034 Alcoholism
    294962 (Gnb4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    294962 (Gnb4)
   05163 Human cytomegalovirus infection
    294962 (Gnb4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    294962 (Gnb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    294962 (Gnb4)
   04031 GTP-binding proteins [BR:rno04031]
    294962 (Gnb4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   294962 (Gnb4)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    294962 (Gnb4)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A
Other DBs
NCBI-GeneID: 294962
NCBI-ProteinID: NP_001013932
RGD: 1359321
Ensembl: ENSRNOG00000011070
UniProt: O35353
Position
2q24
AA seq 340 aa
MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYA
MHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDGQIITSSGDTTCALWDIETGQQTTTF
TGHSGDVMSLSLSPDLKTFVSGACDASSKLWDIRDGMCRQSFTGHISDINAVSFFPSGYA
FATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCSVWDAL
KGGRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtgagctggagcagctgaggcaggaggctgaacagctccggaatcagatccaggat
gctcggaaggcctgcaacgatgccacactggttcagatcacgtctaatatggactccgtg
ggccgaatacaaatgcgaacaaggcgcacgctgcgcggccacctcgccaagatctacgcc
atgcactggggatacgattccaggctactagtcagtgcttcccaagatggaaaattaatt
atttgggatagctatacaacaaataagatgcacgccatcccgctgaggtcctcctgggtc
atgacctgtgcctatgccccgtctgggaactacgtagcctgtggaggcttggacaacatc
tgctccatatacaacctgaagactcgtgaggggaacgtgagagtgagccgggagctgcca
gggcacacaggctacttgtcctgctgccgattcttagatgacggacaaatcattacaagt
tctggagacacgacttgtgctttgtgggacatcgagaccggacagcagacgaccaccttc
acaggacactcgggggacgtgatgagcctctcactgagtcctgacttgaagacctttgtt
tctggtgcttgcgatgcatcttcaaaactgtgggatatccgagacgggatgtgtagacag
tctttcacaggacacatctcagacatcaatgctgtcagcttcttcccgagtggatatgcc
tttgccactggttctgatgacgccacctgccgactctttgacctccgtgcagaccaggag
ctcctgctgtattcccatgacaatatcatctgtggcatcacttctgtggccttctcaaag
agcgggcgcctcctgctagccggctatgacgacttcaactgcagtgtgtgggacgctctg
aaaggaggtcgggcaggtgtccttgctggtcatgacaaccgtgttagctgcttaggtgtg
actgatgacggcatggctgtggccactggctcctgggacagttttctcagaatctggaat
tga

DBGET integrated database retrieval system