KEGG   Rattus norvegicus (rat): 295541
Entry
295541            CDS       T01003                                 

Gene name
Msh4
Definition
(RefSeq) mutS homolog 4
  KO
K08740  DNA mismatch repair protein MSH4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    295541 (Msh4)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutS homologs specialized for meiosis
     295541 (Msh4)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_IV AAA_14 AAA_23 AAA_30 AAA_29 Rad17 AAA_21 G-alpha ATPase_2
Other DBs
NCBI-GeneID: 295541
NCBI-ProteinID: NP_001099947
RGD: 1309190
Ensembl: ENSRNOG00000010431
UniProt: F1M9U4
Position
2q45
AA seq 911 aa
MLRQEATSLSSSPRWTPSRREVPRRRTPASASRPSTEGAVADRSSSSSSSSPAPAAAPGS
SFGNKRSYTTHKAASNFPVGTSSSSAQDTTYPHTFRTPLSAGNPQRSYKGWTPQVGLSAT
SSAVSAHAPSVIVAVVEGRGLARGEIGMASIDLKSPQIMLSQFADNTTYAKVITKLQVLS
PLEIIMSNTACVVGNSTKLFTLITENFKNVNFTTVQRKYFNETKGLEYIEQLCIAEFSSV
LMEVQSRYYCLAAAAALLKYVEFIQNSVYAPKSLKIYFQGSEQTAMIDSSSAQNLELLVN
NQDYRSNHTLFGVLNYTKTAGGSRRLRSNILEPLVDVETISMRLDCVQELLQDEELFYGL
QSVISRFLDTEQLLSVLVQIPKQDTVNAAESKITNLIYLKHTLELVDPLKVALKNCSTPL
LRAYYGSLEDHRFGLILEKIKTVINDDARYMKGCLNMRTQKCYAVRSNISEFLDIARRTY
TEIVDDIAGMISQLAEKYSLPLRTSFSSARGFFIQMTTDCAALSSDQLPSEFIKISKVKN
SYSFTSADLIKMNERCQESLREIYHMTYMIVCKLLSEIYEHIHCLYKLSDTVSMLDMLLS
FAHACTLSDYVRPEFTDTLAIKQGWHPILEKISAEKPVANNTYITEGSNVLIITGPNMSG
KSTFLKQIALCQIMAQIGSFVPAQYASFRIAAQIFTRISTDDDIETNSSTFMKEMKEIAY
ILHNANDKSLILIDELGRGTNTEEGTGISYAVCEHLLSTKAFTLFTTHFLELCHIDTLYL
NVENMHFEVQHVKNTSRNKDAILYTYKLSRGLTEEKHYGLKAAEASSLPPSIVLDAREIT
TQITRQISQNRRSSPEMDRQRAVYHLATRLVQVARNSQLEPDRLRTYLSNLKKKYEGDFP
RAADLPEKTEE
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgctgaggcaggaggctacttcgctctcgagttccccacggtggacgccatcccggagg
gaggtcccccgccggaggacgccggcctccgcgtccaggccgagcacagaaggtgccgtg
gccgacaggagcagcagcagcagcagcagcagcccggcgccggcggccgctccaggttca
tcatttggaaacaaaagatcttacactacacacaaagctgcatccaattttcctgttggt
acgagctcgtcttctgcacaagataccacgtatccacatacgtttagaactccgttatct
gctggaaatccccagagatcatataaaggttggacaccacaagtaggactttcagccaca
tcctccgcggtgtctgcacatgccccgtcagtcattgtagcagtggtggaaggaagaggg
ctggctagaggcgagataggaatggcaagcatcgatttaaaaagcccacagattatgttg
tcacagtttgcagacaacacaacatatgcaaaggtgatcactaaactccaagttttatca
cctttagaaataataatgtcaaatactgcttgtgttgtgggaaattcaaccaagttattt
actctgatcacagaaaattttaagaacgttaatttcactacagtccaaaggaaatacttc
aacgaaacaaagggcttagagtacattgaacagttgtgcatagctgagttcagctctgtc
ctaatggaggttcagtccaggtattactgccttgcagctgccgcagccttattaaaatat
gttgaatttattcaaaattcagtgtatgcacccaaatcgctaaagatttatttccaaggt
agtgagcagacagccatgatagattcatcatcagcccaaaacctggagctgttagttaat
aaccaggactacaggagtaatcacactctctttggtgttttaaattacaccaagactgca
ggagggagcagaaggctgcgctccaacatcctggagccgctggttgatgtggaaacaatc
agcatgaggctggactgtgtccaggagctgcttcaggacgaggagctcttctatggactc
cagtcagtcatatcaagattcctggacacagagcagctgctttctgttttggttcagatt
ccaaagcaagacacggttaatgcagctgaatcaaagataacaaacttgatttatctgaag
cacacattggaacttgtggatcctttaaaggttgctttaaagaactgtagcacgccttta
ctaagagcttactatggctccttggaagaccataggtttgggctaatacttgagaagatt
aaaacagtgataaatgatgatgcaaggtacatgaagggctgcctgaacatgcggactcag
aagtgctatgcagtgcgctccaacatcagtgagttcctggacatagccaggaggacatac
acagagatagtggacgacatagcaggaatgatatcacagctcgcagagaagtacagtctt
cccttacggaccagcttcagctccgcgagggggtttttcatccagatgaccacagactgc
gctgcgctctccagtgaccagcttccttcagagtttattaagatttctaaagtgaaaaac
tcatatagctttacatcagcagatttaattaaaatgaatgaaagatgccaagagtctttg
cgagaaatctatcacatgacctacatgatagtgtgcaagctgctcagtgagatctacgag
cacatccattgcttgtacaagctctcggacacagtgtcaatgctggacatgctgctgtcg
tttgctcatgcctgcactctctctgactacgttcgaccagagtttactgacactttagcc
atcaaacaaggatggcatcccattcttgaaaaaatatctgcagagaaacctgttgcaaac
aatacatatatcacagaagggagtaacgttctgatcatcactggaccaaatatgagtgga
aagtccacgttcttaaagcagattgctctttgtcagatcatggcccagatcggctccttc
gtcccagcacagtacgcctccttcaggattgctgcgcagatctttacgagaatcagcact
gatgatgatattgaaacaaactcttcaacatttatgaaagaaatgaaagagatagcatat
attcttcacaatgctaacgacaagtcactcatactgattgatgagcttggcagaggcact
aatacagaagaagggactggtatttcttatgctgtctgtgagcatctgctgagcacaaag
gcatttacactcttcactacccatttcctggaactgtgccatatagacaccctgtatctt
aatgtagaaaacatgcattttgaagttcagcatgtgaagaatacctcaagaaataaggat
gcaattttgtatacttacaaactttccaggggactcacagaagaaaaacactatggatta
aaagctgcagaagcctcctcacttccaccatcaattgtcttggatgccagagagatcaca
acacaaattacaaggcaaatctcgcaaaaccgaaggagttcccctgagatggatagacag
agagctgtgtaccatctggctacaaggcttgtccaggtcgctcgaaactctcagttggag
ccggacaggctgcggacatatctgagtaatctcaagaagaagtatgaaggggactttccc
agggctgcggaccttccagagaagactgaggagtga

DBGET integrated database retrieval system