KEGG   Rattus norvegicus (rat): 295596Help
Entry
295596            CDS       T01003                                 

Gene name
Orc4
Definition
(RefSeq) origin recognition complex, subunit 4
  KO
K02606  origin recognition complex subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    295596 (Orc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    295596 (Orc4)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    295596 (Orc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC4_C AAA_16 AAA AAA_22 ATPase_2 AAA_19 NACHT AAA_14 T2SSE DAP3 TniB AAA_18 DUF815 NB-ARC DUF2075 cobW KAP_NTPase AAA_23 ABC_tran AAA_29 AAA_7 Septin G-alpha AAA_33 Rad17 RsgA_GTPase SRPRB AAA_30 AAA_24 MobB AAA_5 Mg_chelatase NTPase_1 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 295596
NCBI-ProteinID: NP_954523
RGD: 735212
Ensembl: ENSRNOG00000005021
UniProt: Q6P9Z8
Position
3q12
AA seq 434 aa AA seqDB search
MSNRKSKNNIHAECLSQVQRILRERFCHHTPHSNLFGVQVQYKHLIELLKRTAIYGESNS
LLIVGPRGSGKTTLLNHALKELMQIGDMSENVLQVHLNGLLQTNDKIALKEITRQLNLEN
VVGDKVFGSFAENLSFLLEALQKGNRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDISQS
AQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEFPD
KIFAEKWNENAHCLSEDSTVLEVLQKHFNVNKNLQSLHMLLMLALNRVTVTHPFMTSADL
MEAQHLCSLDAKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQRKAH
SVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQKYSNCP
TDVRQWATSSLSWL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgtaaaagcaagaataacatacatgcagagtgtctttcccaggtacaaaga
attttacgtgaaaggttttgtcatcatactcctcatagcaacctatttggagtgcaagta
caatacaagcatttaattgagctactcaaaagaactgctatctatggagaaagtaattct
ttactcattgttggaccacgaggatcaggaaagaccacgttattaaatcatgccttgaaa
gagctcatgcaaataggagacatgagtgaaaatgtgttacaagttcacttaaatggactg
ctacagacaaatgataaaattgctctgaaagagatcacaagacaattaaatctagaaaat
gtagttggagataaagtttttggaagctttgctgaaaacctttcgtttcttctggaagct
ttgcagaaaggtaaccggactagcagttgcccagtgatcttcatactggatgaatttgat
ctttttgctcatcagaaaaaccaaacactcctttataatctttttgacatttctcaatct
gcacagacaccaatagcagttattggccttacatgtagactggatattttggaactctta
gaaaagagagtgaagtcacgattttctcaccggcagatacatttaatgaattcatttgat
tttccgcaatatttgaaaatatttaaagaacaattatctctacctgcagaattcccagat
aagatttttgctgagaaatggaatgagaatgctcattgtctctccgaagattcaactgtg
cttgaagttctacagaagcatttcaatgtcaacaaaaacttgcaatcattacatatgcta
ttgatgcttgctttaaatcgagtaaccgtgacacacccatttatgacctcagcagatctg
atggaggcgcagcacttgtgtagcttggatgccaaagcgagtattgtacatggtctgtca
gtcttggaaatctgtcttataatagcaatgaaacatttaaatgacatatatgaagaggag
ccctttaattttcaaatggtgtataatgaatttcagaaattcattcaaagaaaggcccat
tctgtttataactttgagaaacctgtggtcatgaaggcatttgagcacttacaacaattg
gaattaataaaacccatggaaagaacctcagtcaattctcagagagaataccagctagtc
aaactacttttggataatactcagattatgaatgccctacagaaatactccaactgccct
acagatgtcaggcagtgggcaacatcctcgctcagctggctgtga

DBGET integrated database retrieval system