KEGG   Rattus norvegicus (rat): 295607
Entry
295607            CDS       T01003                                 

Gene name
Prpf40a, Fnbp3
Definition
(RefSeq) pre-mRNA processing factor 40 homolog A
  KO
K12821  pre-mRNA-processing factor 40
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    295607 (Prpf40a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    295607 (Prpf40a)
Spliceosome [BR:rno03041]
 Complex A
  U1 snRNP components
   U1 related factors
    295607 (Prpf40a)
 Complex B
    295607 (Prpf40a)
SSDB
Motif
Pfam: FF WW
Other DBs
NCBI-GeneID: 295607
NCBI-ProteinID: NP_001099950
RGD: 1311401
Ensembl: ENSRNOG00000004864
UniProt: D3ZJ92
Position
3q12
AA seq 953 aa
MRPGTGAERGGLMVSEMESQPPSRGPGDGERRLSGSNLCSSSWVSADGFLRRRPSMGHPG
MHYAPMGMHPMGQRANMPPVPHGMMPQMMPPMGGPPMGQMPGMMSSVMSGMMMSHMSQAS
MQPALPPGVNSMDVAAGAASGAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQ
LLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLEGYQNTIVAGGLITKSNLHAMI
KAEESSKQEECTTTSTAPVPTTEIPTTMSTMAAAEAAAAVVAAAAAAAAAANANTSTTPT
NTVGSVPVAPEPEVTSIVATAVDNENTVTASAEEQAQLANTTALQDLSGDISSNTGEEPP
KQETVTDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN
DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYK
KAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANV
TYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRER
RRQRKNRESFQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFY
VEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSL
LEKAEAREREREKEEARKMKRKESAFKSMLKQATPPIELDAVWEDIRERFVKEPAFEDIT
LESERKRIFKDFMHVLEHECQHHHSKNKKHSKKSKKHHRKRSRSRSGSDSDDDDSHSKKK
RQRSESHSASEHSSSAESERSYKKSKKHKKKSKKRRHKSDSPESDTEREKDKKEKDRESE
KDRSRQRSESKHKSPKKKTGKDSGNWDTSGSELSEGELEKRRRTLLEQLDDDQ
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgaggccggggactggagccgagcgtggaggcctcatggtgagtgaaatggagagccaa
cctccctcgcggggtcccggggacggggagcggagattgtccggctcaaacctgtgctcc
agttcttgggtctctgctgacggcttcctgaggagacggccctcgatggggcatcctggc
atgcattatgcaccaatgggcatgcaccctatgggtcagcgagcaaacatgcctcctgta
cctcacggaatgatgccacagatgatgcctcctatgggagggcctccaatgggacaaatg
cctggaatgatgtcttcagtaatgtcaggaatgatgatgtctcatatgtctcaggcttcc
atgcaacctgctttaccgcctggagtgaacagtatggatgtagcagcaggtgcagcatct
ggtgcgaaatcaatgtggacagaacataaatcacctgatggaaggacttattactataat
actgaaacaaaacagtctacctgggaaaagccagatgatcttaaaacacctgctgagcaa
ctattgtctaaatgcccatggaaagagtacaaatctgattctgggaagccttattactat
aattctcaaacaaaagagtcccgctgggccaaacctaaggaacttgaagatcttgaagga
taccagaataccattgttgctggaggtcttattacaaaatcaaacctgcatgccatgatc
aaagcagaagaaagcagcaagcaagaagaatgtactacaacatcaacagccccagttcct
acgacagaaattcctaccactatgagcaccatggctgctgcagaagcagcagctgctgtt
gtcgcagctgctgcagccgctgcagcagcagctaatgccaatacttccaccacacctact
aatactgtgggaagtgttccagttgctcctgaacctgaagttacttccattgttgctact
gctgttgataatgagaatacagtgactgcatcagctgaggagcaagcacagcttgctaat
actacagctcttcaagacctaagtggcgatatatccagtaacactggagaggaaccacct
aaacaagaaactgtaaccgattttactcctaaaaaagaagaggaagagagccaaccagca
aaaaaaacatatacttggaatacaaaggaggaggcaaagcaagcatttaaagaattattg
aaagaaaagcgggtaccctccaatgcttcatgggagcaagctatgaaaatgatcataaat
gatcctcggtacagtgctttagcaaagctgagtgagaagaagcaggcatttaatgcctat
aaagtccagacagagaaggaggaaaaagaagaagcaagatcaaaatacaaagaagctaag
gaatcctttcagcgttttcttgaaaatcatgaaaaaatgacttccacaaccagatacaaa
aaagctgagcaaatgtttggggagatggaagtttggaatgcaatatcagagcgtgatcgt
cttgaaatctatgaagacgttttgttcttcctttcaaagaaagaaaaggaacaagcaaag
cagttacgaaagagaaattgggaagccttaaaaaacatacttgacaatatggctaatgtt
acatactctaccacttggtctgaagcccagcagtatctgatggataatccaacgttcgca
gaggatgaagagttacagaacatggataaagaagatgcattaatatgctttgaggaacac
atccgagctttagaaaaggaagaagaagaagaaaaacagaagactttgttgagagaaagg
aggaggcagcgtaaaaatagggaatcttttcagatctttctagacgagttgcatgagcac
gggcagctgcactctatgtcctcttggatggagctgtatccgaccattagctctgacatt
cgattcactaatatgctgggtcagcctggatcaactgcacttgatcttttcaagttttat
gttgaagatcttaaagcacgatatcatgatgaaaaaaagataataaaagacattctgaag
gataaaggatttgtagttgaagtaaacactacttttgaagattttgtggcaataatcagt
tcaaccaaaagatcaaccactttggatgctggaaatatcaagttggctttcaatagttta
ctagaaaaggcagaagcccgtgaacgtgagagagaaaaggaagaagctcggaaaatgaaa
cgaaaagagtctgcctttaagagtatgttgaaacaggccactcctccaatagaactggat
gctgtctgggaagatatccgggaaagatttgtgaaggaaccagcatttgaggatataact
ctagaatctgaaagaaaaagaatatttaaagatttcatgcatgtgcttgagcatgaatgt
cagcatcatcattcaaagaacaagaaacattctaagaaatctaaaaaacaccataggaaa
cgctcccgctctcgatcgggatcagactcagatgatgatgacagccattcaaagaaaaaa
agacagcgatcagaatcccattctgcttcagaacattcttctagtgctgagtctgagaga
agttacaagaaatcaaaaaagcataagaagaaaagcaaaaagaggagacataaatctgac
tctccagaatcagatactgaacgagagaaggataaaaaagaaaaagatcgggaaagtgaa
aaagacagaagtaggcagagatcagaatcaaaacacaaatcacctaagaaaaagactgga
aaggattctggtaactgggatacttctggcagtgaactgagtgaaggggaattagaaaag
cgcagaagaacccttttggagcaactggacgatgatcaataa

DBGET integrated database retrieval system