KEGG   Rattus norvegicus (rat): 29571Help
Entry
29571             CDS       T01003                                 

Gene name
Scn10a, Na(V)1.8, Nav1.8, PN3
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 10
  KO
K04842  voltage-gated sodium channel type X alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29571 (Scn10a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   29571 (Scn10a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Na_trans_assoc PKD_channel GPHH Na_trans_cytopl UPF0242 IQ
Motif
Other DBs
NCBI-GeneID: 29571
NCBI-ProteinID: NP_058943
RGD: 3629
Ensembl: ENSRNOG00000032473
UniProt: Q62968
Position
8q32
AA seq 1957 aa AA seqDB search
MELPFASVGTTNFRRFTPESLAEIEKQIAAHRAAKKARTKHRGQEDKGEKPRPQLDLKDC
NQLPKFYGELPAELVGEPLEDLDPFYSTHRTFMVLNKSRTISRFSATWALWLFSPFNLIR
RTAIKVSVHSWFSIFITITILVNCVCMTRTDLPEKVEYVFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGAAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVRKLADVTILTVFCLSVFALVGLQLFKGNLKNKCIRNGTDPHKADNLSSEMAEYIFIK
PGTTDPLLCGNGSDAGHCPGGYVCLKTPDNPDFNYTSFDSFAWAFLSLFRLMTQDSWERL
YQQTLRASGKMYMVFFVLVIFLGSFYLVNLILAVVTMAYEEQSQATIAEIEAKEKKFQEA
LEVLQKEQEVLEALGIDTTSLQSHSGSPLASKNANERRPRVKSRVSEGSTDDNRSPQSDP
YNQRRMSFLGLSSGRRRASHGSVFHFRAPSQDISFPDGITPDDGVFHGDQESRRGSILLG
RGAGQTGPLPRSPLPQSPNPGRRHGEEGQLGVPTGELTAGAPEGPALHTTGQKSFLSAGY
LNEPFRAQRAMSVVSIMTSVIEELEESKLKCPPCLISFAQKYLIWECCPKWRKFKMALFE
LVTDPFAELTITLCIVVNTVFMAMEHYPMTDAFDAMLQAGNIVFTVFFTMEMAFKIIAFD
PYYYFQKKWNIFDCVIVTVSLLELSASKKGSLSVLRTLRLLRVFKLAKSWPTLNTLIKII
GNSVGALGNLTFILAIIVFIFALVGKQLLSEDYGCRKDGVSVWNGEKLRWHMCDFFHSFL
VVFRILCGEWIENMWVCMEVSQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTA
PEDDGEVNNLQLALARIQVLGHRASRAIASYISSHCRFHWPKVETQLGMKPPLTSSEAKN
HIATDAVSAAVGNLTKPALSSPKENHGDFITDPNVWVSVPIAEGESDLDELEEDMEQASQ
SSWQEEDPKGQQEQLPQVQKCENHQAARSPASMMSSEDLAPYLGESWKRKDSPQVPAEGV
DDTSSSEGSTVDCPDPEEILRKIPELADDLDEPDDCFTEGCTRRCPCCNVNTSKSPWATG
WQVRKTCYRIVEHSWFESFIIFMILLSSGALAFEDNYLEEKPRVKSVLEYTDRVFTFIFV
FEMLLKWVAYGFKKYFTNAWCWLDFLIVNISLTSLIAKILEYSDVASIKALRTLRALRPL
RALSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFSKCVDTRNNPF
SNVNSTMVNNKSECHNQNSTGHFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVD
SGEINSQPNWENNLYMYLYFVVFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEE
QKKYYNAMKKLGSKKPQKPIPRPLNKYQGFVFDIVTRQAFDIIIMVLICLNMITMMVETD
EQGEEKTKVLGRINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVILSIGSLLFSA
ILKSLENYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVM
FIYSIFGMASFANVVDEAGIDDMFNFKTFGNSMLCLFQITTSAGWDGLLSPILNTGPPYC
DPNLPNSNGSRGNCGSPAVGIIFFTTYIIISFLIVVNMYIAVILENFNVATEESTEPLSE
DDFDMFYETWEKFDPEATQFIAFSALSDFADTLSGPLRIPKPNQNILIQMDLPLVPGDKI
HCLDILFAFTKNVLGESGELDSLKTNMEEKFMATNLSKASYEPIATTLRWKQEDLSATVI
QKAYRSYMLHRSLTLSNTLHVPRAEEDGVSLPGEGYITFMANSGLPDKSETASATSFPPS
YDSVTRGLSDRANINPSSSMQNEDEVAAKEGNSPGPQ
NT seq 5874 nt NT seq  +upstreamnt  +downstreamnt
atggagctcccctttgcgtccgtgggaactaccaatttcagacggttcactccagagtca
ctggcagagatcgagaagcagattgctgctcaccgcgcagccaagaaggccagaaccaag
cacagaggacaggaggacaagggcgagaagcccaggcctcagctggacttgaaagactgt
aaccagctgcccaagttctatggtgagctcccagcagaactggtcggggagcccctggag
gacctagaccctttctacagcacacaccggacattcatggtgttgaataaaagcaggacc
atttccagattcagtgccacttgggccctgtggctcttcagtcccttcaacctgatcaga
agaacagccatcaaagtgtctgtccattcctggttctccatattcatcaccatcactatt
ttggtcaactgcgtgtgcatgacccgaactgatcttccagagaaagtcgagtacgtcttc
actgtcatttacaccttcgaggctctgattaagatactggcaagagggttttgtctaaat
gagttcacttatcttcgagatccgtggaactggctggacttcagtgtcattaccttggcg
tatgtgggtgcagcgatagacctccgaggaatctcaggcctgcggacattccgagttctc
agagccctgaaaactgtttctgtgatcccaggactgaaggtcatcgtgggagccctgatc
cactcagtgaggaagctggccgacgtgactatcctcacagtcttctgcctgagcgtcttc
gccttggtgggcctgcagctctttaaggggaaccttaagaacaaatgcatcaggaacgga
acagatccccacaaggctgacaacctctcatctgaaatggcagaatacatcttcatcaag
cctggtactacggatcccttactgtgcggcaatgggtctgatgctggtcactgccctgga
ggctatgtctgcctgaaaactcctgacaacccggattttaactacaccagctttgattcc
tttgcgtgggcattcctctcactgttccgcctcatgacgcaggactcctgggagcgcctg
taccagcagacactccgggcttctgggaaaatgtacatggtctttttcgtgctggttatt
ttccttggatcgttctacctggtcaatttgatcttggccgtggtcaccatggcgtatgaa
gagcagagccaggcaacaattgcagaaatcgaagccaaggaaaaaaagttccaggaagcc
cttgaggtgctgcagaaggaacaggaggtgctggaagccctggggattgacacgacctcg
ctccagtcccacagtggatcacccttagcctccaaaaacgccaatgagagaagacccagg
gtgaaatcaagggtgtcagagggctccacggatgacaacaggtcaccccaatctgaccct
tacaaccagcgcaggatgtctttcctaggcctgtcttcaggaagacgcagggctagccac
ggcagtgtgttccacttccgagcgcccagccaagacatctcatttcctgacgggatcacc
cctgatgatggggtctttcacggagaccaggaaagccgtcgaggttccatattgctgggc
aggggtgctgggcagacaggtccactccccaggagcccactgcctcagtcccccaaccct
ggccgtagacatggagaagagggacagctcggagtgcccactggtgagcttaccgctgga
gcgcctgaaggcccggcactgcacactacagggcagaagagcttcctgtctgcgggctac
ttgaacgaacctttccgagcacagagggccatgagcgttgtcagtatcatgacttctgtc
attgaggagcttgaagagtctaagctgaagtgcccaccctgcttgatcagcttcgctcag
aagtatctgatctgggagtgctgccccaagtggaggaagttcaagatggcgctgttcgag
ctggtgactgaccccttcgcagagcttaccatcaccctctgcatcgtggtgaacaccgtc
ttcatggccatggagcactaccccatgaccgatgccttcgatgccatgcttcaagccggc
aacattgtcttcaccgtgtttttcacaatggagatggccttcaagatcattgccttcgac
ccctactattacttccagaagaagtggaatatcttcgactgtgtcatcgtcaccgtgagc
cttctggagctgagtgcatccaagaagggcagcctgtctgtgctccgtaccttacgcttg
ctgcgggtcttcaagctggccaagtcctggcccaccctgaacaccctcatcaagatcatc
gggaactcagtgggggccctgggcaacctgacctttatcctggccatcatcgtcttcatc
ttcgccctggtcggaaagcagcttctctcagaggactacgggtgccgcaaggacggcgtc
tccgtgtggaacggcgagaagctccgctggcacatgtgtgacttcttccattccttcctg
gtcgtcttccgaatcctctgcggggagtggatcgagaacatgtgggtctgcatggaggtc
agccagaaatccatctgcctcatcctcttcttgactgtgatggtgctgggcaacctagtg
gtgctcaaccttttcatcgctttactgctgaactccttcagcgcggacaacctcacggct
ccagaggatgacggggaggtgaacaacttgcagttagcactggccaggatccaggtactt
ggccatcgggccagcagggccatcgccagttacatcagcagccactgccgattccactgg
cccaaggtggagacccagctgggcatgaagcccccactcaccagctcagaggccaagaac
cacattgccactgatgctgtcagtgctgcagtggggaacctgacaaagccagctctcagt
agccccaaggagaaccacggggacttcatcactgatcccaacgtgtgggtctctgtgccc
attgctgagggggaatctgacctcgacgagctcgaggaagatatggagcaggcttcgcag
agctcctggcaggaagaggaccccaagggacagcaggagcagttgccacaagtccaaaag
tgtgaaaaccaccaggcagccagaagcccagcctccatgatgtcctctgaggacctggct
ccatacctgggtgagagctggaagaggaaggatagccctcaggtccctgccgagggagtg
gatgacacgagctcctctgagggcagcacggtggactgcccggacccagaggaaatcctg
aggaagatccccgagctggcagatgacctggacgagcccgatgactgtttcacagaaggc
tgcactcgccgctgtccctgctgcaacgtgaatactagcaagtctccttgggccacaggc
tggcaggtgcgcaagacctgctaccgcatcgtggagcacagctggtttgagagtttcatc
atcttcatgatcctgctcagcagtggagcgctggcctttgaggataactacctggaagag
aaaccccgagtgaagtccgtgctggagtacactgaccgagtgttcaccttcatcttcgtc
tttgagatgctgctcaagtgggtagcctatggcttcaaaaagtatttcaccaatgcctgg
tgctggctggacttcctcattgtgaacatctccctgacaagcctcatagcgaagatcctt
gagtattccgacgtggcgtccatcaaagcccttcggactctccgtgccctccgaccgctg
cgggctctgtctcgattcgaaggcatgagggtagtggtggatgccctcgtgggcgccatc
ccctccatcatgaacgtcctcctcgtctgcctcatcttctggctcatcttcagcatcatg
ggcgtgaacctcttcgccgggaaattttcgaagtgcgtcgacaccagaaataacccattt
tccaacgtgaattcgacgatggtgaataacaagtccgagtgtcacaatcaaaacagcacc
ggccacttcttctgggtcaacgtcaaagtcaacttcgacaacgtcgctatgggctacctc
gcacttcttcaggtggcaaccttcaaaggctggatggacataatgtatgcagctgttgat
tccggagagatcaacagtcagcctaactgggagaacaacttgtacatgtacctgtacttc
gtcgttttcatcattttcggtggcttcttcacgctgaatctctttgttggggtcataatc
gacaacttcaaccaacagaaaaaaaagctaggaggccaggacatcttcatgacagaagag
cagaagaagtactacaatgccatgaagaagctgggctccaagaaaccccagaagcccatc
ccacggcccctgaataagtaccaaggcttcgtgtttgacatcgtgaccaggcaagccttt
gacatcatcatcatggttctcatctgcctcaacatgatcaccatgatggtggagaccgac
gagcagggcgaggagaagacgaaggttctgggcagaatcaaccagttctttgtggccgtc
ttcacgggcgagtgtgtgatgaagatgttcgccctgcgacagtactacttcaccaacggc
tggaacgtgttcgacttcatagtggtgatcctgtccattgggagtctgctgttttctgca
atccttaagtcactggaaaactacttctccccgacgctcttccgggtcatccgtctggcc
aggatcggccgcatcctcaggctgatccgagcagccaaggggattcgcacgctgctcttc
gccctcatgatgtccctgcccgccctcttcaacatcggcctcctcctcttcctcgtcatg
ttcatctactccatcttcggcatggccagcttcgctaacgtcgtggacgaggccggcatc
gacgacatgttcaacttcaagacctttggcaacagcatgctgtgcctgttccagatcacc
acctcggccggctgggacggcctcctcagccccatcctcaacacggggcctccctactgc
gaccccaacctgcccaacagcaacggctcccgggggaactgcgggagcccggcggtgggc
atcatcttcttcaccacctacatcatcatctccttcctcatcgtggtcaacatgtacatc
gcagtgattctggagaacttcaacgtagccaccgaggagagcacggagcccctgagcgag
gacgacttcgacatgttctatgagacctgggagaagttcgacccggaggccacccagttc
attgccttttctgccctctcagacttcgcggacacgctctccggccctcttagaatcccc
aaacccaaccagaatatattaatccagatggacctgccgttggtccccggggataagatc
cactgtctggacatcctttttgccttcacaaagaacgtcttgggagaatccggggagttg
gactccctgaagaccaatatggaagagaagtttatggcgaccaatctctccaaagcatcc
tatgaaccaatagccaccaccctccggtggaagcaggaagacctctcagccacagtcatt
caaaaggcctaccggagctacatgctgcaccgctccttgacactctccaacaccctgcat
gtgcccagggctgaggaggatggcgtgtcacttcccggggaaggctacattacattcatg
gcaaacagtggactcccggacaaatcagaaactgcctctgctacgtctttcccgccatcc
tatgacagtgtcaccaggggcctgagtgaccgggccaacattaacccatctagctcaatg
caaaatgaagatgaggtcgctgctaaggaaggaaacagccctggacctcagtga

DBGET integrated database retrieval system