KEGG   Rattus norvegicus (rat): 29571
Entry
29571             CDS       T01003                                 

Gene name
Scn10a
Definition
(RefSeq) sodium channel protein type 10 subunit alpha
  KO
K04842  voltage-gated sodium channel type X alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29571 (Scn10a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   29571 (Scn10a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc PKD_channel GPHH CcmD_alt Na_trans_cytopl IQ
Other DBs
NCBI-GeneID: 29571
NCBI-ProteinID: NP_058943
RGD: 3629
Ensembl: ENSRNOG00000032473
UniProt: Q62968
Position
8
AA seq 1956 aa
MELPFASVGTTNFRRFTPESLAEIEKQIAAHRAAKKARTKHRGQEDKGEKPRPQLDLKAC
NQLPKFYGELPAELVGEPLEDLDPFYSTHRTFMVLNKSRTISRFSATWALWLFSPFNLIR
RTAIKVSVHSWFSIFITITILVNCVCMTRTDLPEKVEYVFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGAAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVRKLADVTILTVFCLSVFALVGLQLFKGNLKNKCIRNGTDPHKADNLSSEMAEYIFIK
PGTTDPLLCGNGSDAGHCPGGYVCLKTPDNPDFNYTSFDSFAWAFLSLFRLMTQDSWERL
YQQTLRASGKMYMVFFVLVIFLGSFYLVNLILAVVTMAYEEQSQATIAEIEAKEKKFQEA
LEVLQKEQEVLAALGIDTTSLQSHSGSPLASKNANERRPRVKSRVSEGSTDDNRSPQSDP
YNQRRMSFLGLSSGRRRASHGSVFHFRAPSQDISFPDGITDDGVFHGDQESRRGSILLGR
GAGQTGPLPRSPLPQSPNPGRRHGEEGQLGVPTGELTAGAPEGPALDTTGQKSFLSAGYL
NEPFRAQRAMSVVSIMTSVIEELEESKLKCPPCLISFAQKYLIWECCPKWRKFKMALFEL
VTDPFAELTITLCIVVNTVFMAMEHYPMTDAFDAMLQAGNIVFTVFFTMEMAFKIIAFDP
YYYFQKKWNIFDCVIVTVSLLELSASKKGSLSVLRTFRLLRVFKLAKSWPTLNTLIKIIG
NSVGALGNLTFILAIIVFIFALVGKQLLSEDYGCRKDGVSVWNGEKLRWHMCDFFHSFLV
VFRILCGEWIENMWVCMEVSQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTAP
EDDGEVNNLQLALARIQVLGHRASRAIASYISSHCRFRWPKVETQLGMKPPLTSSEAKNH
IATDAVSAAVGNLTKPALSSPKENHGDFITDPNVWVSVPIAEGESDLDELEEDMEQASQS
SWQEEDPKGQQEQLPQVQKCENHQAARSPASMMSSEDLAPYLGESWKRKDSPQVPAEGVD
DTSSSEGSTVDCPDPEEILRKIPELADDLDEPDDCFTEGCTRRCPCCNVNTSKSPWATGW
QVRKTCYRIVEHSWFESFIIFMILLSSGALAFEDNYLEEKPRVKSVLEYTDRVFTFIFVF
EMLLKWVAYGFKKYFTNAWCWLDFLIVNISLTSLIAKILEYSDVASIKALRTLRALRPLR
ALSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFSKCVDTRNNPFS
NVNSTMVNNKSECHNQNSTGHFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDS
GEINSQPNWENNLYMYLYFVVFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPLNKYQGFVFDIVTRQAFDIIIMVLICLNMITMMVETDE
QGEEKTKVLGRINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVILSIGSLLFSAI
LKSLENYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMF
IYSIFGMASFANVVDEAGIDDMFNFKTFGNSMLCLFQITTSAGWDGLLSPILNTGPPYCD
PNLPNSNGSRGNCGSPAVGIIFFTTYIIISFLIVVNMYIAVILENFNVATEESTEPLSED
DFDMFYETWEKFDPEATQFIAFSALSDFADTLSGPLRIPKPNQNILIQMDLPLVPGDKIH
CLDILFAFTKNVLGESGELDSLKTNMEEKFMATNLSKASYEPIATTLRWKQEDLSATVIQ
KAYRSYMLHRSLTLSNTLHVPRAEEDGVSLPGEGYVTFMANSGLPDKSETASATSFPPSY
DSVTRGLSDRANINPSSSMQNEDEVAAKEGNSPGPQ
NT seq 5871 nt   +upstreamnt  +downstreamnt
atggagctcccctttgcgtccgtgggaactaccaatttcagacggttcactccagagtca
ctggcagagatcgagaagcagattgctgctcaccgcgcagccaagaaggccagaaccaag
cacagaggacaggaggacaagggcgagaagcccaggcctcagctggacttgaaagcctgt
aaccagctgcccaagttctatggtgagctcccagcagaactggtcggggagcccctggag
gacctagaccctttctacagcacacaccggacattcatggtgttgaataaaagcaggacc
atttccagattcagtgccacttgggccctgtggctcttcagtcccttcaacctgatcaga
agaacagccatcaaagtgtctgtccattcctggttctccatattcatcaccatcactatt
ttggtcaactgcgtgtgcatgacccgaactgatcttccagagaaagtcgagtacgtcttc
actgtcatttacaccttcgaggctctgattaagatactggcaagagggttttgtctaaat
gagttcacttatcttcgagatccgtggaactggctggacttcagtgtcattaccttggcg
tatgtgggtgcagcgatagacctccgaggaatctcaggcctgcggacattccgagttctc
agagccctgaaaactgtttctgtgatcccaggactgaaggtcatcgtgggagccctgatc
cactcagtgaggaagctggccgacgtgactatcctcacagtcttctgcctgagcgtcttc
gccttggtgggcctgcagctctttaaggggaaccttaagaacaaatgcatcaggaacgga
acagatccccacaaggctgacaacctctcatctgaaatggcagaatacatcttcatcaag
cctggtactacggatcccttactgtgcggcaatgggtctgatgctggtcactgccctgga
ggctatgtctgcctgaaaactcctgacaacccggattttaactacaccagctttgattcc
tttgcgtgggcattcctctcactgttccgcctcatgacgcaggactcctgggagcgcctg
taccagcagacactccgggcttctgggaaaatgtacatggtctttttcgtgctggttatt
ttccttggatcgttctacctggtcaatttgatcttggccgtggtcaccatggcgtatgaa
gagcagagccaggcaacaattgcagaaatcgaagccaaggaaaaaaagttccaggaagcc
cttgaggtgctgcagaaggaacaggaggtgctggcagccctggggattgacacgacctcg
ctccagtcccacagtggatcacccttagcctccaaaaacgccaatgagagaagacccagg
gtgaaatcaagggtgtcagagggctccacggatgacaacaggtcaccccaatctgaccct
tacaaccagcgcaggatgtctttcctaggcctgtcttcaggaagacgcagggctagccac
ggcagtgtgttccacttccgagcgcccagccaagacatctcatttcctgacgggatcacg
gatgatggggtctttcacggagaccaggaaagccgtcgaggttccatattgctgggcagg
ggtgctgggcagacaggtccactccccaggagcccactgcctcagtcccccaaccctggc
cgtagacatggagaagagggacagctcggagtgcccactggtgagcttaccgctggagcg
cctgaaggcccggcactcgacactacagggcagaagagcttcctgtctgcgggctacttg
aacgaacctttccgagcacagagggccatgagcgttgtcagtatcatgacttctgtcatt
gaggagcttgaagagtctaagctgaagtgcccaccctgcttgatcagcttcgctcagaag
tatctgatctgggagtgctgccccaagtggaggaagttcaagatggcgctgttcgagctg
gtgactgaccccttcgcagagcttaccatcaccctctgcatcgtggtgaacaccgtcttc
atggccatggagcactaccccatgaccgatgccttcgatgccatgcttcaagccggcaac
attgtcttcaccgtgtttttcacaatggagatggccttcaagatcattgccttcgacccc
tactattacttccagaagaagtggaatatcttcgactgtgtcatcgtcaccgtgagcctt
ctggagctgagcgcatccaagaagggcagcctgtctgtgctccgtaccttccgcttgctg
cgggtcttcaagctggccaagtcctggcccaccctgaacaccctcatcaagatcatcggg
aactccgtgggggccctgggcaacctgacctttatcctggccatcatcgtcttcatcttc
gccctggtcggaaagcagcttctctcagaggactacgggtgccgcaaggacggcgtctcc
gtgtggaacggcgagaagctccgctggcacatgtgtgacttcttccattccttcctggtc
gtcttccgaatcctctgcggggagtggatcgagaacatgtgggtctgcatggaggtcagc
cagaaatccatctgcctcatcctcttcttgactgtgatggtgctgggcaacctagtggtg
ctcaaccttttcatcgctttactgctgaactccttcagcgcggacaacctcacggctcca
gaggatgacggggaggtgaacaacttgcagttagcactggccaggatccaggtacttggc
catcgggccagcagggccatcgccagttacatcagcagccactgccgattccgctggccc
aaggtggagacccagctgggcatgaagcccccactcaccagctcagaggccaagaaccac
attgccactgatgctgtcagtgctgcagtggggaacctgacaaagccagctctcagtagc
cccaaggagaaccacggggacttcatcactgatcccaacgtgtgggtctctgtgcccatt
gctgagggggaatctgacctcgacgagctcgaggaagatatggagcaggcttcgcagagc
tcctggcaggaagaggaccccaagggacagcaggagcagttgccacaagtccaaaagtgt
gaaaaccaccaggcagccagaagcccagcctccatgatgtcctctgaggacctggctcca
tacctgggtgagagctggaagaggaaggatagccctcaggtccctgccgagggagtggat
gacacgagctcctctgagggcagcacggtggactgcccggacccagaggaaatcctgagg
aagatccccgagctggcagatgacctggacgagcccgatgactgtttcacagaaggctgc
actcgccgctgtccctgctgcaacgtgaatactagcaagtctccttgggccacaggctgg
caggtgcgcaagacctgctaccgcatcgtggagcacagctggtttgagagtttcatcatc
ttcatgatcctgctcagcagtggagcgctggcctttgaggataactacctggaagagaaa
ccccgagtgaagtccgtgctggagtacactgaccgagtgttcaccttcatcttcgtcttt
gagatgctgctcaagtgggtagcctatggcttcaaaaagtatttcaccaatgcctggtgc
tggctggacttcctcattgtgaacatctccctgacaagcctcatagcgaagatccttgag
tattccgacgtggcgtccatcaaagcccttcggactctccgtgccctccgaccgctgcgg
gctctgtctcgattcgaaggcatgagggtagtggtggatgccctcgtgggcgccatcccc
tccatcatgaacgtcctcctcgtctgcctcatcttctggctcatcttcagcatcatgggc
gtgaacctcttcgccgggaaattttcgaagtgcgtcgacaccagaaataacccattttcc
aacgtgaattcgacgatggtgaataacaagtccgagtgtcacaatcaaaacagcaccggc
cacttcttctgggtcaacgtcaaagtcaacttcgacaacgtcgctatgggctacctcgca
cttcttcaggtggcaaccttcaaaggctggatggacataatgtatgcagctgttgattcc
ggagagatcaacagtcagcctaactgggagaacaacttgtacatgtacctgtacttcgtc
gttttcatcattttcggtggcttcttcacgctgaatctctttgttggggtcataatcgac
aacttcaaccaacagaaaaaaaagctaggaggccaggacatcttcatgacagaagagcag
aagaagtactacaatgccatgaagaagctgggctccaagaaaccccagaagcccatccca
cggcccctgaataagtaccaaggcttcgtgtttgacatcgtgaccaggcaagcctttgac
atcatcatcatggttctcatctgcctcaacatgatcaccatgatggtggagaccgacgag
cagggcgaggagaagacgaaggttctgggcagaatcaaccagttctttgtggccgtcttc
acgggcgagtgtgtgatgaagatgttcgccctgcgacagtactacttcaccaacggctgg
aacgtgttcgacttcatagtggtgatcctgtccattgggagtctgctgttttctgcaatc
cttaagtcactggaaaactacttctccccgacgctcttccgagtcatccgtctggccagg
atcggccgcatcctcaggctgatccgagcagccaaggggattcgcacgctgctcttcgcc
ctcatgatgtccctgcccgccctcttcaacatcggcctcctcctcttcctcgtcatgttc
atctactccatcttcggcatggccagcttcgctaacgtcgtggacgaggccggcatcgac
gacatgttcaacttcaagacctttggcaacagcatgctgtgcctgttccagatcaccacc
tcggccggctgggacggcctcctcagccccatcctcaacacggggcctccctactgcgac
cccaacctgcccaacagcaacggctcccgggggaactgcgggagcccggcggtgggcatc
atcttcttcaccacctacatcatcatctctttcctcatcgtggtcaacatgtacatcgca
gtgattctggagaacttcaacgtggccaccgaggagagcacggagcccctgagcgaggac
gacttcgacatgttctatgagacctgggagaagttcgacccggaggccacccagttcatt
gccttttctgccctctcagacttcgcggacacgctctccggccctcttagaatccccaaa
cccaaccagaatatattaatccagatggacctgccgttggtccccggggataagatccac
tgtctggacatcctttttgccttcacaaagaacgtcttgggagaatccggggagttggac
tccctgaagaccaatatggaagagaagtttatggcgaccaatctctccaaagcatcctat
gaaccaatagccaccaccctccggtggaagcaggaagacctctcagccacagtcattcaa
aaggcctaccggagctacatgctgcaccgctccttgacactctccaacaccctgcatgtg
cccagggctgaggaggatggcgtgtcacttcccggggaaggctatgttacattcatggca
aacagtggactcccggacaaatcagaaactgcctctgctacgtctttcccgccatcctat
gacagtgtcaccaggggtctgagtgaccgggccaacattaacccatctagctcaatgcaa
aatgaagatgaggtcgctgctaaggaaggaaacagccctggacctcagtga

DBGET integrated database retrieval system