KEGG   Rattus norvegicus (rat): 29580
Entry
29580             CDS       T01003                                 

Gene name
Fdft1
Definition
(RefSeq) squalene synthase
  KO
K00801  farnesyl-diphosphate farnesyltransferase [EC:2.5.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00100  Steroid biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    29580 (Fdft1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rno01006]
    29580 (Fdft1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.21  squalene synthase
     29580 (Fdft1)
Prenyltransferases [BR:rno01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   29580 (Fdft1)
SSDB
Motif
Pfam: SQS_PSY Octopine_DH
Other DBs
NCBI-GeneID: 29580
NCBI-ProteinID: NP_062111
RGD: 61834
Ensembl: ENSRNOG00000021314
UniProt: Q02769
Position
15
AA seq 416 aa
MEFVKCLGHPEEFYNLLRFRMGGRRNFIPKMDRNSLSNSLKTCYKYLDQTSRSFAAVIQA
LDGDIRHAVCVFYLILRAMDTVEDDMAISVEKKIPLLRNFHTFLYEPEWRFTESKEKHRV
VLEDFPTISLEFRNLAEKYQTVIADICHRMGCGMAEFLNKDVTSKQDWDKYCHYVAGLVG
IGLSRLFSASEFEDPIVGEDTECANSMGLFLQKTNIIRDYLEDQQEGRQFWPQEVWGKYV
KKLEDFVKPENVDVAVKCLNELITNALQHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL
AACYNNHQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRVPNSDPSASKAK
QLISNIRTQSLPNCQLISRSHYSPIYLSFIMLLAALSWQYLSTLSQVTEDYVQREH
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagttcgtgaagtgtctaggccacccggaggagttctacaacctgctgcgattccgc
atgggaggccggcggaatttcatacccaagatggaccggaactcgctcagcaacagcttg
aagacttgctataagtatcttgatcagaccagtcgcagcttcgccgcggttatccaggcg
ctggatggggacatacgtcatgcggtgtgtgtgttttacctgatcctccgagccatggac
acagtggaggatgacatggccatcagtgtggagaagaagatcccactgctgcgaaacttt
cacactttcctctatgagccggagtggcggttcaccgagagcaaggagaagcaccgagta
gtgctggaggacttccccacgatctccctggagtttagaaatttggctgagaaatatcaa
acagtgatcgctgacatctgtcacaggatgggatgtgggatggcagaatttctaaacaag
gatgtaacctccaaacaggactgggacaagtactgtcactatgttgctggactggtggga
atcggcctttctcgcctattctctgcctcagagtttgaagatcccatagttggtgaagac
acagagtgtgccaattctatgggtctgtttctgcagaaaacaaatatcattcgtgattat
ctggaagaccaacaagaaggaagacagttttggcctcaagaggtatggggcaaatatgtt
aagaagctggaagactttgttaagccagagaacgtagatgtggccgtgaagtgcttgaat
gaactcataaccaacgccctacaacacatccctgacgtcatcacctacctgtcaaggctc
cggaaccaaagtgtgtttaacttctgtgccattccacaggtaatggccattgctacgctg
gctgcctgttacaataaccatcaggtattcaagggagtagtgaagattcggaaggggcaa
gcagttaccctcatgatggatgccaccaacatgccagctgtcaaagctatcatataccag
tacatagaagagatttatcaccgggtccccaactcagacccgtcagctagcaaggccaag
cagctcatctccaacatcaggacgcagagccttcccaattgccagctcatctcccgaagc
cactactcccccatttacctgtccttcatcatgctcttggctgccctgagctggcagtac
ttgagcactctgtcccaggtcacagaagactatgtccagagagaacactga

DBGET integrated database retrieval system