KEGG   Rattus norvegicus (rat): 29583
Entry
29583             CDS       T01003                                 

Gene name
Pecam1, CD31, Pecam
Definition
(RefSeq) platelet and endothelial cell adhesion molecule 1
  KO
K06471  platelet/endothelial cell adhesion molecule
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04670  Leukocyte transendothelial migration
rno05144  Malaria
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    29583 (Pecam1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    29583 (Pecam1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    29583 (Pecam1)
  09174 Infectious disease: parasitic
   05144 Malaria
    29583 (Pecam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    29583 (Pecam1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29583 (Pecam1)
   04091 Lectins [BR:rno04091]
    29583 (Pecam1)
CD molecules [BR:rno04090]
 Proteins
  29583 (Pecam1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   29583 (Pecam1)
Lectins [BR:rno04091]
 I-type lectins (Siglecs)
  29583 (Pecam1)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_C17orf99 ig I-set Ig_5 C2-set_2 Izumo-Ig MAP17 DUF4625 BclA_C
Other DBs
NCBI-GeneID: 29583
NCBI-ProteinID: NP_113779
RGD: 61927
UniProt: Q3SWT0
Position
10q32.1
AA seq 678 aa
MLLALLLTMLLYASLQAQENSFTINSIHMESRPSWEVSNGQKLTLQCLVDISTTSKSRPQ
HQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCTVILNSKEKTTIEYQLTVNGV
PMPEVTVDKKEVTEGGIVTVNCSMQEEKPPIYFKIEKVELGTKNVKLSREKTSNMNFVLI
EFPIEEQDHLLVFRCQAGVLSGIKMQTSEFIRSEYVTVQEFFSTPKFQIQPPEMIIEGNQ
LHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMALVEHSGHYTCKVESNRI
SKASSILVNITELFPRPKLELSSSRLDQGEMLDLSCSVSGAPVANFTIQKEETVLSQYQN
FSKIAEERDSGLYSCTAGIGKVVKRSNLVPVQVCEMLSKPRIFHDAKFEIIKGQIIGISC
QSVNGTAPITYRLLRAKSNFQTVQKNSNDPVTFTDKPTRDMEYQCIVDNCHSHPEVRSEI
LRVKVIAPVDEVTISILSGNDVQSGDEMVLRCSVKEGTGPVTFQFYKEKEGRPFHEETVN
DTQVFWHHEQTSKEQEGQYYCTAFNRASIVTSLRSGPLTVRVFLAPWKKGLIAVVVIGVV
IAALIVAAKYYFLRKAKAKQKPVEMSRPAVPLLNSNSEKVSEPSVETNSHYDSQNMDVEY
TEVEVSSLEPHQENGRLP
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgctcctggctctgctgctcaccatgctgctctatgcaagcctccaggctcaggaaaac
tctttcaccattaacagcatccatatggaaagtcggccctcctgggaggtatcgaatggg
cagaaactgaccctgcagtgccttgtcgatatcagcaccacctcgaaatctaggcctcag
caccaggtgctattctataaggacgatgcgctggtgtacaacgtctcctccagtgagcac
acagagagcttcgtcattcctcagtctcgggtcttccacgccgggaagtacaaatgcacc
gtgatactgaacagcaaggaaaaaaccacaattgagtaccagctgacggtgaacggtgta
cccatgcctgaggtgaccgtggacaaaaaggaggtgacagaaggtgggattgtgacagtc
aattgctccatgcaagaagaaaagccaccaatatattttaaaattgaaaaagtggaactg
gggacaaagaacgtcaagctaagtagagagaagacctccaacatgaactttgtgctcata
gaattccccatcgaggagcaagaccacctgttagtgtttcgctgccaagctggcgtcctg
tccggaatcaaaatgcagacctcagaattcatccggagtgaatacgtcactgtgcaggag
ttcttctctacacccaagtttcaaatccagcctcctgagatgatcatagaaggaaaccag
ctgcacatcaagtgcagcgtgcaggtggcacacttggcccaggaatttccagaaattata
atccagaaagacaaggcgatcgtggccacctccaagcaaagcaaagaagctgtctactca
gtcatggccttggtagagcacagtggacactacacgtgcaaagtggaatcgaaccgcatc
tccaaggccagtagcatcctggtcaacataacagaactgtttcccaggccgaagctagaa
ctctcctccagccgtctggaccaaggggaaatgctggacctgtcctgctctgtctcgggt
gcgcctgtagctaacttcaccatccagaaggaagagacggtgttgtcacagtatcagaat
ttcagcaagattgccgaggagagggacagcgggctgtacagctgtacagcaggcatcggc
aaagtggtcaagagaagcaatttggtacccgtccaggtgtgcgaaatgctctccaaaccc
cggatttttcatgatgccaaatttgagatcataaaaggacaaatcataggtatcagctgc
cagtcagtaaatgggactgcgcccatcacttaccgcctcctaagagcaaagagcaacttc
cagaccgtccagaagaactccaatgacccagtgacattcacagacaagcccaccagagac
atggaataccagtgtatagtggataattgccactctcaccccgaggtgcgcagcgagatc
ctgagggtcaaggtaatagccccggtggatgaagttacgatctccatcctgtcgggtaac
gatgtacagtctggagatgaaatggtgcttcggtgctctgtgaaagaggggactggccct
gtcacgtttcagttttacaaagaaaaggagggcagacccttccacgaagaaaccgtgaat
gacacccaagtgttttggcaccatgaacaaactagcaaggagcaggaaggccagtactat
tgtacagcgttcaacagagccagcattgtgaccagtctccgaagcggccctctaacagtc
agagtctttcttgctccgtggaagaaagggctcattgcagtcgttgtcattggagtggtc
attgccgccttgatagttgcagccaaatactacttcctgaggaaagccaaggccaagcag
aagcccgtggagatgtccaggccagcagtcccacttctgaactccaacagtgagaaggtt
tctgagcccagtgtggaaaccaacagccattacgactcccagaacatggatgtggagtac
acagaagtggaagtgtcctcccttgagcctcaccaagagaacggaaggctcccttga

DBGET integrated database retrieval system