KEGG   Rattus norvegicus (rat): 296178
Entry
296178            CDS       T01003                                 

Gene name
Mcm8
Definition
(RefSeq) minichromosome maintenance 8 homologous recombination repair factor
  KO
K10737  DNA helicase MCM8 [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    296178 (Mcm8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     296178 (Mcm8)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    296178 (Mcm8)
SSDB
Motif
Pfam: MCM MCM_lid MCM_OB Mg_chelatase AAA_5 AAA_3 Sigma54_activat AAA AAA_16 AAA_22 FtsK_SpoIIIE AAA_7 LacI
Other DBs
NCBI-GeneID: 296178
NCBI-ProteinID: NP_001099984
RGD: 1305218
Ensembl: ENSRNOG00000021272
UniProt: D3ZVK1
Position
3q36
AA seq 830 aa
MSGAYRGRGFGRGRFQNWKRGRGGGNFSGRWRDRTDLSKAAGNHASEQASQPLLQQSTLD
QFIPYKGWKLYFSEVYSNNSPLTEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTK
DNEITNLIPDIENALRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLCNGGGTMVN
VPHIYARVYNYEPLTHLKNIRATCYGKYISIRGTVVRVSNIKPLCTKMAFQCAACGEIQS
FPLPDGKYNLPTKCPVPACRGRSFTPLRSSPLTVTMDWQLIKIQELMSDAQREAGRIPRT
IECELVHDLVDSCVPGDTVTVTGIVKVSNSEEGSRSKNDKCMFLLYIEANSVSNSKGQKA
QTAEDGCKHGTLMEFSLKDLYAIQEIQAEENLLKLIVNSLCPVIFGHELVKAGLMLALFG
GSQKYADDKNRIPIRGDPHVLIVGDPGLGKSQMLQAACNVAPRGVYVCGNTATSSGLTVT
LSKDSSSGDFALEAGALVLGDQGICGIDEFDKMGNQHQALLEAMEQQSISLAKAGVVCSL
PARTSIIAAANPVGGHYNKARTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVI
AIRAGKQRAVSSATVSRVLSQDSNTSVLEVVSEKPLSERLKVAPGEKTDPIPHQLLRKYI
GYARQYVHPRLSTEAAQALQDFYLELRKQSQRVGSSPITTRQLESLIRLTEARARLELRE
EATKEDAEDIIEIMKHSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNSIAERT
YNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKIYQLQTM
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgagtggtgcatacagaggcagaggttttggacgaggacgattccaaaactggaaaaga
ggaagaggtggtgggaacttctcaggaaggtggagagacagaactgacctgagtaaagct
gcaggaaatcatgcttctgaacaagcctcacaacctttacttcaacagtcaacattggat
cagtttataccgtataagggctggaagctttacttctctgaagtttacagtaataactct
cctcttactgagaagatccaagcatttgagaaatttttcacaaggcatatcgacttatat
gataaggatgaaatagaaagaaagggaagcatcttggtggattttaaagaactgacaaaa
gacaatgaaataactaacttgataccagatatagaaaatgcactaagagatgcccctgag
aaaacactggcatgtatgggactggcaatacatcaggtattaactaaggaccttgaaagg
cacgcagctgaattacaagctcaagaggggttgtgtaatggtggaggaaccatggtaaat
gtgccacatatttatgcgagagtgtacaactatgagcccttaacacacctcaagaacatc
cgagcaacttgctatgggaagtacatctctataagagggacagtggttcgagtcagtaac
ataaagcctctgtgcaccaaaatggcttttcagtgtgctgcatgtggagagattcagagc
tttcctcttccggatggaaaatacaatcttccaacaaagtgtcctgtgcctgcgtgtcga
gggaggtcatttacgccattgcgcagttctcctctcaccgtcacaatggactggcagttg
atcaaaatccaggagctgatgtctgatgcacagagagaagctggtcggatccctcgaacc
atagaatgtgaacttgttcatgatcttgtagatagctgtgtcccaggagatacggtgact
gttactggaattgtcaaagtttcaaatagtgaagaaggttctcgatctaagaatgataag
tgcatgttccttttgtacattgaagcaaactctgttagcaacagcaaaggacagaaagcc
cagactgcagaggatggttgcaagcatggaacactgatggagttctcccttaaagacctg
tatgccatccaagagatccaggctgaagagaacctgctcaagctcattgtcaactcactt
tgtcctgtcatttttggtcatgaacttgttaaagcaggactgatgttagcgctatttggc
ggtagccagaagtacgcagatgacaaaaacaggattcctattcgaggagacccacacgtc
ctgattgttggagatccaggcttggggaagagtcagatgctgcaggcagcatgcaacgtg
gcgccacgtggtgtgtatgtttgtggaaatacggccaccagctctggtctgacggttact
ctttcaaaagacagttcctcaggagacttcgctttggaagctggtgccctggtacttggt
gaccaaggcatttgtggaatagatgaatttgataaaatggggaatcagcatcaagccttg
ttagaagccatggaacagcagagcattagccttgctaaggccggtgtggtttgcagcctc
cctgcaagaacctccattattgctgcggcaaatccagtcggaggacactacaataaagcg
aggacagtttctgagaatttaaagatggggagtgccctgctgtccaggttcgatttggtc
tttatcttgttagatacaccaaatgaacagcacgaccacttactttctgaacatgtgatc
gcaataagagctgggaagcagagagcggttagcagtgccacagtctctcgtgtgctcagt
caagactcaaatacttctgtacttgaagtggtttccgagaaaccgttatcagaaagacta
aaggtggctcctggagaaaagacagatccgattccacatcagctgctgaggaagtacata
ggctatgcacggcagtatgtccatccaaggttatccacggaagctgctcaggctcttcag
gatttctacctggagctgcgcaagcagagccagcgcgtgggcagctcgcccatcaccact
cggcagctggaatctttgatccgtctgacggaggcacgagcaaggttagaattgagagag
gaagcaactaaagaagacgctgaagatataattgaaattatgaagcatagcatgctagga
acttactcagatgaatttggaaacctggactttgagcgatcccagcatggctctggaatg
agcaacaggtcaacagctaaaagatttatttctgctctcaacagcattgctgaaagaacg
tataacaacatatttcaatttcatcaacttcgtcagattgctaaagagctaaacattcag
gttgctgactttgaaaacttcattggatcactgaatgaccagggttatctcctgaaaaaa
ggcccaaagatttatcaacttcaaactatgtga

DBGET integrated database retrieval system