KEGG   Rattus norvegicus (rat): 296281
Entry
296281            CDS       T01003                                 

Gene name
Plagl2
Definition
(RefSeq) PLAG1 like zinc finger 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 C1_1 zf-C2H2_jaz zf-C2H2_11
Other DBs
NCBI-GeneID: 296281
NCBI-ProteinID: NP_001099998
RGD: 1307999
Ensembl: ENSRNOG00000010086
UniProt: D3ZTE9
Position
3q41
AA seq 175 aa
MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSL
PHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTH
DPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCNWVFSKYIMTPSSS
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaccacatttttcaccagcgtccctccctggattcaagatgcaaagcaggaggaggaa
gtgggctggaaactagttcccaggcctcggggccgggaggcagagagtcaagtgaagtgc
caatgtgaaatctcggggacaccattctcaaatggggagaagctaaggcctcacagcctc
ccccatccggagcagagaccatacagctgtcctcagctgcactgtggcaaggcttttgcc
tccaagtacaagctgtataggcacatggccacccactcagcccagaaaccccaccagtgc
atgtactgtgacaagatgtttcaccgaaaggaccatctgcgcaaccacttgcagacccat
gaccccaacaaggaggccctccactgctctgaatgtggtaagaattataatacaaagctg
gggtaccgtcgccacctggccatgcatgctgccagcagtggtgatctcagctgcaaggtc
tgcaattgggttttctccaagtacatcatgacaccttcgtcctcctga

DBGET integrated database retrieval system