KEGG   Rattus norvegicus (rat): 296284Help
Entry
296284            CDS       T01003                                 

Gene name
Kif3b
Definition
(RefSeq) kinesin family member 3B
  KO
K20196  kinesin family member 3B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    296284 (Kif3b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     296284 (Kif3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd Kinesin_assoc AAA_16
Motif
Other DBs
NCBI-GeneID: 296284
NCBI-ProteinID: NP_001099999
RGD: 1306815
Ensembl: ENSRNOG00000010361
UniProt: D3ZI07
Position
3q41
AA seq 747 aa AA seqDB search
MSKLKSSESVRVVVRCRPMNGKEKAAAYDKVVDVDVKLGQVSVKNPKGTSHEMPKTFTFD
AVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGVRGDPEKRGVIP
NSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLS
SFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITVECSEVGLDGENHIRVGK
LNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRL
LQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQE
EIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEGEEGEEEGDDKDDYWREQQEK
LEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKN
IVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYTSLQQEVDIKTKK
LKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKNKIM
NRSFFDDEEDHWKLHPITRLENQQMMKRPVSAVGYKRPLSQHARMSMMIRPEPRYRAENI
MLLELDMPSRTTRDYEGPAISPKVQAALDAALQDEDEIQVDASSFESTANRKAKARPKSG
RKSGASSSSSGNPASQFYPQSRGLVPK
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagttaaaaagctcagagtcagtccgggtggtagttcgctgtcggcctatgaat
ggcaaggaaaaggctgctgcttatgacaaggtggtagatgtggatgtgaagctggggcag
gtgtctgtgaagaaccccaaaggcacatcccatgagatgcccaagaccttcacctttgat
gctgtatatgattggaacgccaagcagtttgaactctatgatgagacattccgaccactt
gtggactctgtcctgcagggtttcaatggcacaatttttgcctacggacaaacaggaact
gggaaaacctataccatggaaggagtccgtggtgaccctgaaaaaagaggggtcatcccc
aactcctttgatcacatcttcacccacatctctcgatcgcagaatcagcagtatctggtc
agggcatcttacttagagatctatcaggaagagatccgagacttgctttcaaaggatcag
accaaaaggctggagctcaaagagagaccagatacaggagtgtacgtgaaggatttgtcg
tcttttgtcaccaagagtgtgaaggagatagagcatgtgatgaatgtgggaaaccagaac
cggtcggttggtgccaccaacatgaacgagcatagctcgcggtcgcatgcgatctttgtc
atcacggttgaatgcagcgaggtgggcctggacggtgaaaaccacatccgagtaggaaaa
ctgaaccttgtagatcttgctggcagtgagcggcaagccaagactggagctcaaggggaa
agactgaaggaagcgaccaagatcaacctgtccctttcagccttgggtaatgttatctct
gcccttgtagatggcaaaagcacccatattccatatagagactcaaaactgaccaggctt
ctccaggattcccttggtggcaatgccaaaactgtgatggtagccaatgtggggcctgcc
tcttacaatgtagaagagaccctgaccactctgagatatgccaaccgtgccaaaaacatt
aagaacaagccaagggtcaatgaggacccaaaggatgctctgcttcgtgaattccaagaa
gaaattgctcggctcaaggcccagctggaaaaacgttccattggcaggaggaagaggcga
gagaagcggagggaaggtggtggcagtggtgggggtggggaagaggaggaggaggaggga
gaagagggtgaggaggaaggggatgataaggatgattactggcgggaacagcaagaaaaa
ctggagattgagaagcgggccattgtagaggaccacagcttggttgcagaggagaagatg
aggctgctgaaggagaaggagaaaaagatggaggacctgcggcgggagaaggacgctgct
gagatgctgggtgccaaaatcaaggccatggagagtaagctgcttgttggaggaaaaaat
atagtagatcatacaaacgagcagcagaagatcttggaacagaagcgccaggagatcgca
gagcagaaacgtcgagaaagagaaattcagcagcagatggagagtcgagatgaggagacc
ttggaactgaaagagacgtatacctcattgcagcaagaggtagacatcaagaccaaaaaa
ctcaaaaagctattttccaagcttcaggctgtgaaggctgagatccatgacctccaagaa
gaacacatcaaagagcgccaggagctggagcagacgcagaatgagctcaccagagagcta
aagctcaagcatcttattatagaaaactttattcccttggaagagaagaataaaattatg
aatagatccttttttgatgatgaagaagaccattggaaattacatcctataaccagactg
gagaaccagcagatgatgaagaggccagtctctgccgtaggatacaagagaccactgagc
cagcatgcacggatgtccatgatgattcggccagagccccggtacagggcagagaacatc
atgctcttggagttagatatgcccagccggacaaccagagactatgagggcccagcaatt
tctcccaaggttcaggctgcactggatgcagctctgcaagatgaggatgagatacaggtg
gatgcctcttcctttgaaagtactgcaaatagaaaagccaaggccaggcctaagagtggc
aggaaatcaggagcctcctcttcctcctcaggaaaccctgcatctcagttttacccacag
tctcgggggctggttcccaagtaa

DBGET integrated database retrieval system