KEGG   Rattus norvegicus (rat): 296639
Entry
296639            CDS       T01003                                 

Gene name
Ciz1
Definition
(RefSeq) CDKN1A interacting zinc finger protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-C2H2_2 zf-C2H2_4 zf-met zf-C2H2 Fungal_lectin_2
Other DBs
NCBI-GeneID: 296639
NCBI-ProteinID: NP_001100038
RGD: 1305336
Ensembl: ENSRNOG00000013442
UniProt: F1LV60
Position
3p12
AA seq 825 aa
MFNQQLQQQQQLQQLQQQQLQQQQQQILQLQQLLQQSPPQASLSMPVSRGLPQQSSPQQL
LNLQGLNSTSLLNGSMLQRALLLQQLQGLDQFAMPPATYDSASLTMPTAALGNLRAYNVT
APNLAAPSLTPPQMVTPNLQQFFPQATRQSLLGPPPVGIPINPSQHNHSGRNSQKQPRTP
SSTTPNHKDSSSQTVPLDDREDPTEGSEEATELQMDTAEDQDSLVFPDGLASEPQVHEPE
PEPFEALEPPAKRLRSSEESTEKGPTGQPQARVQPQTQMTAPKQTQTPDQLPEPPEALVV
PRIQPQVLQIQTLSKLQKQAQTQTSPEHLAPQQNQVQPQVRSQPQWQLQPWETDPPKQAQ
AQTQPQPLWQAQSHKQAQTQTQTHPQVSTQAQPQEQTSEKTQDQPQTWPQGSAPPPEQAS
VPACATEPQLLSNAAEVGRDPEETLPEPVSAQSSEDRSQEPSAGGLDVGECEKRAGEVLG
MWGAGSSLKVTILQSSNSRAFNTTPLTSGPRPGDSASATPALASTPSKQSLQFFCYICKA
SCSSQQEFQDHMSEAQHQQRLGEMQHSSQTCLLSLLPMPRDILERETEDPPPKRWCNTCQ
VYYMGDLIQHRRTQEHKVAKQSLRPFCTICNRYFKTPRKFVEHVKSQGHKDKAQELKTLE
KETGSPDEDHFITVDAVGCFESGQEEDEDDDEEEEEEIEAEEEFCKQLQSRETSSEQWKD
SETYSPNTAYGVDFLVPVMGYVCRICHKFYDSNSEFRLSHCKSLAHFENLQKYKAKNPSP
PTRPVSRKCAINARNALTALFTSSSGSSRQPSPQDTVKIPSKCPR
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgtttaaccagcaactccagcagcagcaacagttgcagcagctccagcaacagcagctc
cagcagcagcaacagcagatactccagctccaacagctactgcagcagtccccaccacag
gcctccttgtccatgcctgtcagccggggcctcccccagcagtcatccccgcaacagctt
ctgaatctccagggcctcaactcgacctccctgctcaatggctccatgctgcaaagagct
ttgctcctacagcagttgcaaggactggaccagtttgcaatgccaccagccacgtatgac
agtgccagcctcaccatgcctacggcagccttgggcaacctccgtgcttacaatgtgaca
gccccaaacctagcagctcctagccttacaccaccccagatggtcaccccaaatctgcag
cagttctttccccaggctactcgacagtccctgctggggcctcctcctgttgggatccca
ataaacccttctcagcataaccactcagggaggaactcccagaagcagcccagaaccccc
tcttccaccacccccaatcacaaggattcttcttctcagacggtgcctctggacgacagg
gaagaccccacagaggggtctgaggaagccacagagctccagatggacacagctgaagac
caagattcactagtcttcccagatggccttgcgagtgagccccaagtgcatgagcctgag
cctgagccctttgaggcgttggaaccaccagccaagaggttgaggagctcagaggagtcc
accgagaaaggccctacagggcagccacaagcaagggtccagcctcagacccagatgaca
gcaccaaagcagacacagaccccagatcagctgcctgagccaccggaagccctggtggtg
ccgcgaatccagccacaggttctgcagatccagactctgtcaaagctgcagaagcaggca
cagacacagacttctccagagcacttagcgccccagcagaatcaggtacagccacaggta
cggtcacagccccagtggcagttgcagccatgggagacagacccaccgaagcaagctcag
gcacagacccagcctcagcccctctggcaggcgcagtcgcacaagcaggcccagacacag
acacagacacatccacaggtatccacccaagcacagccacaggagcagacatcagagaag
acccaggaccagcctcagacctggccacaggggtcggcacccccaccagaacaagcatca
gttccggcctgtgccacggaaccacagctattatctaacgctgcagaagttgggagagac
ccagaggagaccttgccagaaccagtaagtgcccagagcagtgaagacaggagccaagag
ccgtcagctggtggcctggatgtgggagaatgtgaaaagagagcaggagaagtgctgggg
atgtggggggctgggagctccctgaaggtcaccatcctgcagagtagcaacagccgggct
ttcaacaccacacccctcacatctggacctcgccctggggactccgcctctgccacccct
gcccttgccagcacaccctccaagcaaagcctccagttcttctgctacatctgcaaggcc
agctgcagcagccagcaggagtttcaggatcacatgtcagaggctcagcaccaacagcgg
cttggggaaatgcagcactcgagccagacctgcctgttgtccctgctgcccatgcctcgg
gacatcctggagagagaaacagaagatcctccacccaaacgctggtgcaacacctgccag
gtgtactacatgggagacctgatccagcaccgcaggacacaggagcacaaggttgccaag
cagtccctgaggcccttctgcaccatatgcaaccgttatttcaagacccctcgaaagttt
gtggagcatgtgaagtcccagggacacaaggacaaggcccaggagctgaagacacttgaa
aaagagacaggcagcccagatgaggaccacttcatcaccgtggacgccgttggttgcttt
gagagtggtcaagaagaggacgaggatgatgatgaagaagaggaagaagagattgaggcg
gaggaggaattctgcaagcagctgcagtcaagagaaacatcttcagagcaatggaaggac
tctgagacttacagccccaacacggcctatggtgtggacttcctggtgccagtgatgggc
tatgtctgccgaatctgtcacaagttctacgacagtaactcagaatttcggctctctcac
tgcaagtctctggcccactttgagaacctgcagaaatacaaagccaagaaccccagccct
cctacccggcctgtgagccgcaagtgtgcgatcaacgcccgcaacgccctgactgcactg
ttcacctctagcagtggtagcagccgccagcccagcccccaggacactgtgaagataccc
agcaagtgccctcgatga

DBGET integrated database retrieval system