KEGG   Rattus norvegicus (rat): 29701
Entry
29701             CDS       T01003                                 

Gene name
Scn11a
Definition
(RefSeq) sodium channel protein type 11 subunit alpha
  KO
K04843  voltage-gated sodium channel type XI alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29701 (Scn11a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   29701 (Scn11a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc PKD_channel GPHH
Other DBs
NCBI-GeneID: 29701
NCBI-ProteinID: NP_062138
RGD: 3630
Ensembl: ENSRNOG00000032884
UniProt: O88457
Position
8
AA seq 1765 aa
MEERYYPVIFPDERNFRPFTSDSLAAIEKRIAIQKERKKSKDKAAAEPQPRPQLDLKASR
KLPKLYGDIPPELVAKPLEDLDPFYKDHKTFMVLNKKRTIYRFSAKRALFILGPFNPLRS
LMIRISVHSVFSMFIICTVIINCMFMANSMERSFDNDIPEYVFIGIYILEAVIKILARGF
IVDEFSFLRDPWNWLDFIVIGTAIATCFPGSQVNLSALRTFRVFRALKAISVISGLKVIV
GALLRSVKKLVDVMVLTLFCLSIFALVGQQLFMGILNQKCIKHNCGPNPASNKDCFEKEK
DSEDFIMCGTWLGSRPCPNGSTCDKTTLNPDNNYTKFDNFGWSFLAMFRVMTQDSWERLY
RQILRTSGIYFVFFFVVVIFLGSFYLLNLTLAVVTMAYEEQNRNVAAETEAKEKMFQEAQ
QLLREEKEALVAMGIDRSSLNSLQASSFSPKKRKFFGSKTRKSFFMRGSKTAQASASDSE
DDASKNPQLLEQTKRLSQNLPVDLFDEHVDPLHRQRALSAVSILTITMQEQEKFQEPCFP
CGKNLASKYLVWDCSPQWLCIKKVLRTIMTDPFTELAITICIIINTVFLAVEHHNMDDNL
KTILKIGNWVFTGIFIAEMCLKIIALDPYHYFRHGWNVFDSIVALLSLADVLYNTLSDNN
RSFLASLRVLRVFKLAKSWPTLNTLIKIIGHSVGALGNLTVVLTIVVFIFSVVGMRLFGT
KFNKTAYATQERPRRRWHMDNFYHSFLVVFRILCGEWIENMWGCMQDMDGSPLCIIVFVL
IMVIGKLVVLNLFIALLLNSFSNEEKDGSLEGETRKTKVQLALDRFRRAFSFMLHALQSF
CCKKCRRKNSPKPKETTESFAGENKDSILPDARPWKEYDTDMALYTGQAGAPLAPLAEVE
DDVEYCGEGGALPTSQHSAGVQAGDLPPETKQLTSPDDQGVEMEVFSEEDLHLSIQSPRK
KSDAVSMLSECSTIDLNDIFRNLQKTVSPKKQPDRCFPKGLSCHFLCHKTDKRKSPWVLW
WNIRKTCYQIVKHSWFESFIIFVILLSSGALIFEDVNLPSRPQVEKLLRCTDNIFTFIFL
LEMILKWVAFGFRRYFTSAWCWLDFLIVVVSVLSLMNLPSLKSFRTLRALRPLRALSQFE
GMKVVVYALISAIPAILNVLLVCLIFWLVFCILGVNLFSGKFGRCINGTDINMYLDFTEV
PNRSQCNISNYSWKVPQVNFDNVGNAYLALLQVATYKGWLEIMNAAVDSREKDEQPDFEA
NLYAYLYFVVFIIFGSFFTLNLFIGVIIDNFNQQQKKLGGQDIFMTEEQKKYYNAMKKLG
TKKPQKPIPRPLNKCQAFVFDLVTSQVFDVIILGLIVLNMIIMMAESADQPKDVKKTFDI
LNIAFVVIFTIECLIKVFALRQHYFTNGWNLFDCVVVVLSIISTLVSRLEDSDISFPPTL
FRVVRLARIGRILRLVRAARGIRTLLFALMMSLPSLFNIGLLLFLVMFIYAIFGMSWFSK
VKKGSGIDDIFNFETFTGSMLCLFQITTSAGWDTLLNPMLEAKEHCNSSSQDSCQQPQIA
VVYFVSYIIISFLIVVNMYIAVILENFNTATEESEDPLGEDDFEIFYEVWEKFDPEASQF
IQYSALSDFADALPEPLRVAKPNKFQFLVMDLPMVMGDRLHCMDVLFAFTTRVLGDSSGL
DTMKTMMEEKFMEANPFKKLYEPIVTTTKRKEEEQGAAVIQRAYRKHMEKMVKLRLKDRS
SSSHQVFCNGDLSSLDVAKVKVHND
NT seq 5298 nt   +upstreamnt  +downstreamnt
atggaggagaggtactacccggtgatcttcccggacgagcggaatttccgccccttcact
tccgactctctggctgccatagagaagcggattgctatccaaaaggagaggaagaagtcc
aaagacaaggcggcagctgagccccagcctcggcctcagcttgacctaaaggcctccagg
aagttacctaagctttatggtgacattccccctgagcttgtagcgaagcctctggaagac
ctggacccattctacaaagaccataagacattcatggtgttgaacaagaagagaacaatt
tatcgcttcagcgccaagcgggccttgttcattctggggccttttaatcccctcagaagc
ttaatgattcgtatctctgtccattcagtctttagcatgttcatcatctgcacggtgatc
atcaactgtatgttcatggcgaattctatggagagaagtttcgacaacgacattcccgaa
tacgtcttcattgggatttatattttagaagctgtgattaaaatattggcaagaggcttc
attgtggatgagttttccttcctccgagatccgtggaactggctggacttcattgtcatt
ggaacagcgatcgcaacttgttttccgggcagccaagtcaatctttcagctcttcgtacc
ttccgagtgttcagagctctgaaggcgatttcagttatctcaggtctgaaggtcatcgta
ggtgccctgctgcgctcggtgaagaagctggtagacgtgatggtcctcactctcttctgc
ctcagcatctttgccctggtcggtcagcagctgttcatgggaattctgaaccagaagtgt
attaagcacaactgtggccccaaccctgcatccaacaaggattgctttgaaaaggaaaaa
gatagcgaagacttcataatgtgtggtacctggctcggcagcagaccctgtcccaatggt
tctacgtgcgataaaaccacattgaacccagacaataattatacaaagtttgacaacttt
ggctggtcctttctcgccatgttccgggttatgactcaagactcctgggagaggctttac
cgacagatcctgcggacctctgggatctactttgtcttcttcttcgtggtggtcatcttc
ctgggctccttctacctgcttaacctaaccctggctgttgtcaccatggcttatgaagaa
cagaacagaaatgtagctgctgagacagaggccaaggagaaaatgtttcaggaagcccag
cagctgttaagggaggagaaggaggctctggttgccatgggaattgacagaagttccctt
aattcccttcaagcttcatccttttccccgaagaagaggaagtttttcggtagtaagaca
agaaagtccttctttatgagagggtccaagacggcccaagcctcagcgtctgattcagag
gacgatgcctctaaaaatccacagctccttgagcagaccaaacgactgtcccagaacttg
ccagtggatctctttgatgagcacgtggaccccctccacaggcagagagcgctgagcgct
gtcagtatcttaaccatcaccatgcaggaacaagaaaaattccaggagccttgtttccca
tgtgggaaaaatttggcctctaagtacctggtgtgggactgtagccctcagtggctgtgc
ataaagaaggtcctgcggaccatcatgacggatccctttactgagctggccatcaccatc
tgcatcatcatcaataccgttttcttagccgtggagcaccacaacatggatgacaactta
aagaccatactgaaaataggaaactgggttttcacgggaattttcatagcggaaatgtgt
ctcaagatcatcgcgctcgacccttaccactacttccggcacggctggaatgtttttgac
agcatcgtggccctcctgagtctcgctgatgtgctctacaacacactgtctgataacaat
aggtctttcttggcttccctcagagtgctgagggtcttcaagttagccaaatcctggccc
acgttaaacactctcattaagatcatcggccactccgtgggcgcgcttggaaacctgact
gtggtcctgactatcgtggtcttcatcttttctgtggtgggcatgcggctcttcggcacc
aagtttaacaagaccgcctacgccacccaggagcggcccaggcggcgctggcacatggat
aatttctaccactccttcctggtggtgttccgcatcctctgtggggaatggatcgagaac
atgtggggctgcatgcaggatatggacggctccccgttgtgcatcattgtctttgtcctg
ataatggtgatcgggaagcttgtggtgcttaacctcttcattgccttgctgctcaattcc
ttcagcaatgaggagaaggatgggagcctggaaggagagaccaggaaaaccaaagtgcag
ctagccctggatcggttccgccgggccttctccttcatgctgcacgctcttcagagtttt
tgttgcaagaaatgcaggaggaaaaactcgccaaagccaaaagagacaacagaaagcttt
gctggtgagaataaagactcaatcctcccggatgcgaggccctggaaggagtatgataca
gacatggctttgtacactggacaggccggggctccgctggccccactcgcagaggtagag
gacgatgtggaatattgtggtgaaggcggtgccctacccacctcacaacatagtgctgga
gttcaggccggtgacctccctccagagaccaagcagctcactagcccggatgaccaaggg
gttgaaatggaagtattttctgaagaagatctgcatttaagcatacagagtcctcgaaag
aagtctgacgcagtgagcatgctctcggaatgcagcacaattgacctgaatgatatcttt
agaaatttacagaaaacagtttcccccaaaaagcagccagatagatgctttcccaagggc
cttagttgtcactttctatgccacaaaacagacaagagaaagtccccctgggtcctgtgg
tggaacattcggaaaacctgctaccaaatcgtgaagcacagctggtttgagagtttcata
atctttgttattctgctgagcagtggagcgctgatatttgaagatgtcaatctccccagc
cggccccaagttgagaaattactaaggtgtaccgataatattttcacatttattttcctc
ctggaaatgatcctgaagtgggtggcctttggattccggaggtatttcaccagtgcctgg
tgctggcttgatttcctcattgtggtggtgtctgtgctcagtctcatgaatctaccaagc
ttgaagtccttccggactctgcgggccctgagacctctgcgggcgctgtcccagtttgaa
ggaatgaaggttgtcgtctacgccctgatcagcgccatacctgccattctcaatgtcttg
ctggtctgcctcattttctggctcgtattttgtatcttgggagtaaatttattttctggg
aagtttggaaggtgcattaacgggacagacataaatatgtatttggattttaccgaagtt
ccgaaccgaagccaatgtaacattagtaattactcgtggaaggtcccgcaggtcaacttt
gacaacgtggggaatgcctatctcgccctgctgcaagtggcaacctataagggctggctg
gaaatcatgaatgctgctgtcgattccagagagaaagacgagcagccggactttgaggcg
aacctctacgcgtatctctactttgtggtttttatcatcttcggctccttctttaccctg
aacctctttatcggtgttattattgacaacttcaatcagcagcagaaaaagttaggtggc
caagacatttttatgacagaagaacagaagaaatattacaatgcaatgaaaaagttagga
accaagaaacctcaaaagcccatcccaaggcccctgaacaaatgtcaagcctttgtgttc
gacctggtcacaagccaggtctttgacgtcatcattctgggtcttattgtcttaaatatg
attatcatgatggctgaatctgccgaccagcccaaagatgtgaagaaaacctttgatatc
ctcaacatagccttcgtggtcatctttaccatagagtgtctcatcaaagtctttgctttg
aggcaacactacttcaccaatggctggaacttatttgattgtgtggtcgtggttctttct
atcattagtaccctggtttcccgcttggaggacagtgacatttctttcccgcccacgctc
ttcagagtcgtccgcttggctcggattggtcgaatcctcaggctggtccgggctgcccgg
ggaatcaggaccctcctctttgctttgatgatgtctctcccctctctcttcaacatcggt
ctgctgctcttcctggtgatgttcatttacgccatctttgggatgagctggttttccaaa
gtgaagaagggctccgggatcgacgacatcttcaacttcgagacctttacgggcagcatg
ctgtgcctcttccagataaccacttcggctggctgggataccctcctcaaccccatgctg
gaggcaaaagaacactgcaactcctcctcccaagacagctgtcagcagccgcagatagcc
gtcgtctacttcgtcagttacatcatcatctccttcctcatcgtggtcaacatgtacatc
gctgtgatcctcgagaacttcaacacagccacggaggagagcgaggaccctctgggagag
gacgactttgaaatcttctatgaggtctgggagaagtttgaccccgaggcgtcgcagttc
atccagtattcggccctctctgactttgcggacgccctgccggagccgttgcgtgtggcc
aagccgaataagtttcagtttctagtgatggacttgcccatggtgatgggcgaccgcctc
cattgcatggatgttctctttgctttcactaccagggtcctcggggactccagcggcttg
gataccatgaaaaccatgatggaggagaagtttatggaggccaacccttttaagaagctc
tacgagcccatagtcaccaccaccaagaggaaggaggaggagcaaggcgccgccgtcatc
cagagggcctaccggaaacacatggagaagatggtcaaactgaggctgaaggacaggtca
agttcatcgcaccaggtgttttgcaatggagacttgtccagcttggatgtggccaaggtc
aaggttcacaatgactga

DBGET integrated database retrieval system