KEGG   Rattus norvegicus (rat): 297066
Entry
297066            CDS       T01003                                 

Gene name
Zfp212
Definition
(RefSeq) Zinc finger protein 212
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    297066 (Zfp212)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    297066 (Zfp212)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    297066 (Zfp212)
SSDB
Motif
Pfam: zf-C2H2 KRAB zf-C2H2_4 zf-H2C2_2 DUF3669 zf-C2H2_6 zf-met zf-C2H2_jaz DUF3268 DZR zinc_ribbon_15 zf-C2HC_2 zinc_ribbon_9
Other DBs
NCBI-GeneID: 297066
NCBI-ProteinID: XP_006224968
RGD: 1307836
Ensembl: ENSRNOG00000006711
UniProt: G3V6U6
Position
4q24
AA seq 492 aa
MAESTPARHRRKRRSTPLAPATPPSQTTEKSQYFQTTEISLWTVVAAIQAVEKKMESQAA
RLQSLEGRAGSAEKKLADFEKTAVEFSNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRN
KNFWVLRLPPGSKGETPKVSGPLENDGVCFSEQEWENLEDWQKELYRNVMESNYETLVSL
KVLGQPEEEVELGAEMVGDLVEEGTHLADRAMVKQEMLYKQEGPSGLPSMFSSAAEPQAC
FGSEQAVFWNSPGDSALLESGPGDSNPESVESSRDPAPGRNLDCPRKQKSHRQVQLGQEC
GQGPKVKRDTSPYKCSECQISFRYKQQLTAHLQSHTSRESYSATEPEESLRPRPRLKPQA
KRSKLHQCDVCHRSFSCKVSLVTHQRCHQQEGPSTSPQIQERFSPNSLVALPGHIPWRKS
RSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCPECEKSFVQKQHLLQHQKIHQRERGG
LASESARPNGLL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcggagtcgacgcctgctcggcacaggaggaaaaggcgctccacaccgttagctcca
gccacaccaccttcacagacaacagagaaaagccagtacttccagaccacagaaatctca
ctttggacagtggtggctgctattcaagctgtggagaagaagatggaatcccaggctgcc
cgactgcagagcctggagggacgcgcagggtcagcggagaagaagctggctgacttcgag
aagacagctgtggagttcagcaaccagctggagggcaagtgggccgtgctggggacccta
ctgcaggagtacggcctgctgcagcgacggctggagaatgtggagaacctgcttcgaaac
aagaacttctgggtccttcgactgcccccaggcagcaagggggagaccccaaaggtgtcc
gggccccttgagaatgatggggtctgtttctcagaacaggagtgggagaacctggaggac
tggcagaaggagctctacagaaatgttatggaaagcaactatgagacgctggtctctcta
aaggtccttggccagccagaggaagaagtggagttgggcgcagagatggtgggtgacttg
gtggaagaaggtacccacctggcagacagggccatggttaaacaggagatgctgtacaag
caggagggcccctcaggtcttcccagcatgttttccagtgctgctgaacctcaggcttgc
tttggctcagaacaggctgtgttctggaatagtccaggagattctgccctcttggaatca
ggccctggggactcaaaccctgagtctgttgagagcagtagagaccctgcccctggtaga
aatctggactgccctcgaaaacagaagtctcacagacaggtgcaactgggtcaagagtgt
ggacagggtccgaaggtgaaaagggacaccagcccgtacaaatgttccgaatgccagatc
agctttcgctacaagcagcagttgactgcacatttgcagagccacacaagcagagaatct
tactctgccacagagccagaggagagccttagacccagaccccggctgaaaccacaggcc
aaaaggtcgaagctgcatcagtgtgatgtgtgccacaggagcttcagctgcaaggtcagt
cttgtgacccaccagcggtgccatcagcaggaaggccccagcaccagcccacaaatccag
gagagattctccccaaacagcttagttgctttgcctggccacatcccttggaggaaaagt
cgaagctctctcatctgtgggtactgtggcaaaagtttcagccacccatcagacttggtt
cggcaccagcgcatccacacgggtgagaggccctacagttgccccgaatgtgagaagagc
tttgtccagaagcagcacctcctgcagcaccagaaaatccaccagcgggaacggggtggg
ctggcttcagagtctgcaagacctaatggtctgctttaa

DBGET integrated database retrieval system