KEGG   Rattus norvegicus (rat): 297076
Entry
297076            CDS       T01003                                 

Gene name
Gimap6, Ian6
Definition
(RefSeq) GTPase, IMAP family member 6
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: AIG1 MMR_HSR1 AAA_7 Dynamin_N Septin T2SSE ABC_tran FeoB_N AAA_29 SRPRB G-alpha
Other DBs
NCBI-GeneID: 297076
NCBI-ProteinID: NP_001011968
RGD: 1305041
Ensembl: ENSRNOG00000033338
UniProt: Q5FVN6
Position
4q24
AA seq 304 aa
MNWLYSKTLGSIGSCCIDTLPWPFHSFFQRNLLALPGEPGNPLESSATESGKQSRSCLSA
SPVMEEEGCEHSLQKNPTRQLPLDPGQELTKDLKEKKLTPKRLQLLLVGKTGSGKSATGN
SILGRQVFESKISARPVTMAFQKGSRELEGKELEVIDTPDILSPQNQPEATAKKICDILA
SPGPHAVLLVIQVGRYTTEDQEAARCLQEIFGNGILAYTILVFTRKEELAEGSLEEYIKE
NNNKTLDALDVACERRHCGFNNRAQGDEQEAQLQKLMEEIESILWENEGHCYTMELPNVS
SKTL
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaattggctttacagtaaaacgctcgggtccattggctcatgctgtatagacactttg
ccctggccgttccattccttctttcagagaaaccttctggccctaccaggagagccagga
aatccactggagtccagtgcgactgaaagtgggaaacagagccgttcttgcctgtcagcc
agcccagtgatggaagaagaagggtgtgaacacagcctccagaagaatcccacaaggcag
ttgcccctggaccctggacaagaattgacaaaagatctgaaggagaaaaagctcactcca
aagagactgcagctccttctggtggggaagacaggaagtgggaaaagtgcaacaggaaac
agcatccttggcaggcaagtatttgagtccaaaatcagcgctcgaccagtgaccatggca
ttccagaaaggcagcagggagttggaggggaaggaacttgaggtgatcgacaccccagat
attttgtcacctcagaaccagcctgaggcaacagctaagaagatctgtgacatcttggcc
tcaccagggcctcatgcagtgctcctggtgatacaggtaggccggtacaccacagaggat
caggaggctgccaggtgcctccaggagatctttggaaacgggatcctggcttacactatt
ctggtgttcacccggaaggaagaactggccgagggctctttagaagaatatattaaagag
aacaacaataagaccctggatgctctggatgttgcatgtgagagacgccattgtggcttc
aacaacagggcacaaggggatgagcaggaggcccagttgcagaaacttatggaggaaatt
gagtcgatcttgtgggaaaatgagggccattgttacaccatggaacttccaaatgtctcc
agcaaaaccctttaa

DBGET integrated database retrieval system