KEGG   Rattus norvegicus (rat): 29710
Entry
29710             CDS       T01003                                 

Gene name
Scn8a
Definition
(RefSeq) sodium channel protein type 8 subunit alpha
  KO
K04840  voltage-gated sodium channel type VIII alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29710 (Scn8a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   29710 (Scn8a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc Na_trans_cytopl PKD_channel IQ GPHH
Other DBs
NCBI-GeneID: 29710
NCBI-ProteinID: NP_062139
RGD: 3638
Ensembl: ENSRNOG00000005309
UniProt: O88420
Position
7
AA seq 1978 aa
MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLE
AGKSLPFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNL
IRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNPPEWSKNVEYTFTGIYTFESLVKIIAR
GFCIDGFTFLRDPWNWLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGF
DWEEYINNKTNFYMVPGMLEPLLCGNSSDAGQCPEGFQCMKAGRNPNYGYTSFDTFSWAF
LALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQA
TLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSAGTVSEDAIEEEGEDGVGSPRSSSEL
SKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKF
SIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDS
LFIPIRARERRSSYSGYSGYSQCSRSSRIFPSLRRSVKRNSTVDCNGVVSLIGPGSHIGR
LLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEESQRKCPPC
WYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFE
HVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGLSV
LRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYK
ECVCKINQECKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMV
IGNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKVKVHAFMQAH
FKQREADEVKPLDELYEKKANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYIIDED
HMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPE
VEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFET
FIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTN
AWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVG
AIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIDIVNNKTDCEKLMEG
NSTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPDYEGNIYMYI
YFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQK
PIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFV
IFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLA
RIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGI
DDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVG
IFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQF
IEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGEL
DILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICRKMAS
NKLENGGTHRDKKESTPSTASLPSYDSVTKPDKEKQQRAEEGRRERAKRQKEVRESKC
NT seq 5937 nt   +upstreamnt  +downstreamnt
atggcagcgcggctgctcgcaccaccaggccctgatagtttcaagcctttcacccctgag
tcgctggcaaacatcgagaggcgtattgccgagagcaagctcaagaaaccaccaaaggcg
gatggcagccaccgggaagacgatgaagacagcaagcccaagccaaacagtgacctggag
gctgggaagagtttgcctttcatctacggggacatcccgcaaggcctggttgcggttccc
ctggaggactttgacccttactatttgacgcagaaaacctttgtagtattaaacagaggg
aaaactctcttcagatttagtgccacacctgccttgtacattttaagcccttttaacctg
ataagaagaatagctattaaaattttgatacactcagttttcagcatgatcatcatgtgc
accatcctgaccaactgtgtgttcatgacctttagtaaccctccagaatggtccaagaat
gtggagtacacattcacagggatttacacatttgaatcactagtgaaaatcatcgcaaga
ggtttctgcatagacggcttcaccttcttacgagacccgtggaactggttagacttcagt
gtcatcatgatggcatatgtgacagagtttgtggacctgggcaatgtctcagcgctgaga
acattcagggttctccgagctttgaaaactatctctgtaattccaggcctgaagacaatc
gtgggcgccctaatccagtccgtgaagaagctgtcggacgtgatgatcctgacagtgttc
tgcctgagtgttttcgccctgattggcctgcagctcttcatggggaaccttcgaaacaag
tgtgtcgtgtggcccataaacttcaacgagagctacctggagaacggcaccagaggcttt
gactgggaggagtatatcaacaataaaacaaacttttacatggttcctggcatgctagaa
cccttgctctgcgggaacagttctgatgctgggcaatgcccagagggattccagtgcatg
aaagcaggaaggaaccccaactacggttacaccagctttgacaccttcagctgggccttc
ttggcattattccgccttatgacccaggactattgggagaacttataccagctgacctta
cgagccgctgggaaaacgtacatgatcttctttgtcttggtcatcttcgtgggttctttc
tatctggtgaacttgatcttggctgtggtggccatggcttatgaggaacagaaccaggca
acactggaggaggcagagcaaaaagaggccgagttcaaggcaatgctggagcaactcaag
aagcagcaggaggaggcacaggctgctgcaatggccacctcagcgggcactgtctcggaa
gacgccattgaagaagaaggggaagatggggtaggctctccgaggagctcatctgaactg
tctaaactcagttccaagagcgcgaaggagcggcggaaccgacggaagaagaggaagcag
aaggagctctctgaaggcgaggagaaaggggacccagagaaggtgtttaagtcagagtcg
gaagacggtatgagaaggaaggccttccggctgccagacaacaggatagggaggaagttt
tccatcatgaatcagtcgctgctcagcattccaggctcgcccttcctctcccgacataac
agcaaaagcagcatcttcagcttccggggacccggtcggttccgggaccccggctctgag
aatgagttcgcagacgatgaacacagcaccgtggaggagagcgagggccggcgtgactcg
ctcttcatcccgatccgcgcccgcgagcgccgcagcagctacagtggctacagcggctac
agccagtgcagccgctcgtcgcgcatcttccccagcctgcggcgcagcgtgaagcgcaac
agcacggtggactgcaacggcgtggtgtcactcatcgggcccggctcacacatcgggcgg
ctcctgcctgaggcaacgactgaggtggaaattaagaagaaaggccctggatctctttta
gtttctatggaccaactcgcctcctacggacggaaggacagaatcaacagcataatgagc
gtggtcacaaacacgctagtggaagagctggaagagtctcagagaaagtgcccaccgtgc
tggtataagtttgccaacactttcctcatctgggagtgtcacccctactggataaaactg
aaggagatcgtgaacttaatcgtcatggacccttttgtagacttagccatcaccatctgc
atcgttctgaatacgctatttatggcaatggagcaccatcccatgacaccacagttcgaa
cacgtcttggccgtaggaaatctggtgttcaccgggatcttcacggcggaaatgtttctg
aagctcatagccatggacccctactattatttccaagaaggctggaacatttttgacgga
tttattgtctccctcagtttaatggagctgagtctcgcagatgtggaggggctctcagtg
ctgcggtctttccgactgctccgagtcttcaagctggccaagtcctggcccaccctgaac
atgctgatcaagatcatcgggaactccgtgggtgccctgggcaacctgaccctggtgctg
gccatcatcgtcttcatcttcgccgtggtggggatgcagctgtttggaaagagttacaag
gagtgcgtctgtaagatcaaccaggagtgcaagctcccgcgctggcacatgaacgacttc
ttccactccttcctcatcgtcttccgagtgctgtgtggggagtggatcgagaccatgtgg
gactgcatggaggtggccggccaggccatgtgcctcattgtcttcatgatggttatggtc
attggcaacctggtggtgctgaacctattcctggccttgcttctgagctccttcagcgca
gacaacctggcggccacagacgacgacggggaaatgaacaacctgcagatctcagtgatc
cggatcaagaagggcgtggcctggaccaaagtgaaggtgcacgccttcatgcaggctcac
ttcaagcagcgggaggcggatgaagtgaaacccctcgacgagctgtatgagaagaaggcc
aactgcatcgccaaccacacgggcgtggatatccaccggaacggcgacttccagaagaac
gggaacggaaccaccagcggcatcggcagcagcgtggagaagtacatcatcgacgaggac
cacatgtccttcattaacaacccaaacctgaccgtccgggtgcccattgctgtgggcgag
tctgacttcgagaacctcaacacagaggatgttagcagcgaatcagaccctgaaggcagc
aaagataaactggacgataccagctcctcagaaggaagtaccatcgacatcaagcctgag
gtggaagaagttcccgtggagcaacctgaggaatacttggatccggacgcctgctttaca
gagggttgcgtccagcggttcaagtgctgccaggtcaacatcgaggaaggactaggcaag
tcgtggtggatcttgcggaaaacctgcttcctcattgtggagcacaattggtttgagacc
ttcatcatcttcatgattctgctcagcagtggcgccctggcctttgaggacatctacatt
gagcagaggaagaccatccgcaccatcctggagtatgcggacaaggtcttcacctacatc
ttcatcctggagatgttgctcaagtggacagcctacggcttcgtcaagttcttcaccaat
gcctggtgctggttggacttcctcattgtggctgtctctttagtcagccttatagctaat
gccctgggctactcggaactaggtgccataaagtcccttaggaccctaagagctttgaga
cccttaagagccttatcacgatttgaagggatgagggtggtggtgaatgccttggtgggc
gccatcccctccatcatgaatgtgctgctggtgtgtctcatcttctggctgattttcagc
atcatgggagttaacctgtttgcggggaaataccactactgctttaacgagacttctgaa
atccggttcgaaatcgatattgtcaacaataaaacggactgtgagaagctcatggagggc
aacagcacggagatccgatggaagaatgtcaagatcaactttgacaatgtcggagcaggg
tacctggcccttcttcaagtggcaaccttcaaaggctggatggacatcatgtatgcggct
gtagattcccgaaagccagacgagcagcctgactacgagggcaacatctacatgtacatc
tacttcgtcatcttcatcatcttcggctccttcttcaccctcaacctgttcatcggtgtc
atcatcgacaacttcaaccagcagaagaaaaagtttggaggtcaggacatcttcatgaca
gaggaacagaagaagtactacaatgccatgaaaaagctgggctccaagaagccacagaag
cccatcccccgacccttgaacaaaatccaagggattgtctttgatttcgtcactcaacaa
gcctttgacattgtgatcatgatgctcatctgccttaacatggtgacaatgatggtggag
acagacactcagagcaagcagatggagaacattctttactggattaatctggtctttgtc
atcttcttcacctgcgagtgtgtgctcaaaatgtttgccttgagacactactatttcacc
attggctggaacatctttgactttgtggtggtcatcctctccattgtgggaatgttcctg
gctgatatcattgagaagtacttcgtctccccaaccctattccgagttatccgattggcc
cgtattgggcgcatcttgcgtctgatcaagggcgccaaagggatccgcaccctgctcttt
gccttaatgatgtcgctgcccgccctgttcaacatcggcctcctgctcttcctcgtcatg
ttcatcttctccatttttggcatgtccaacttcgcatacgtgaagcacgaggccggcatt
gacgacatgttcaacttcgagacatttggcaacagcatgatctgtttgttccagatcaca
acgtctgctggctgggatggcctgctgctgccaatcctgaaccgcccccctgactgcagc
ttggacaaagagcacccagggagtggcttcaaaggggactgtgggaacccctcggtgggc
atcttcttctttgtgagctacatcatcatctccttcctgattgtggtgaacatgtacatc
gccatcatcctggagaacttcagcgtggccaccgaggagagcgccgaccctctgagtgag
gatgacttcgagactttctatgagatctgggagaagtttgacccagacgccacccagttc
atcgagtactgtaagctggcagactttgccgacgccctggagcacccgctccgagtaccc
aagcccaacaccatcgagctcatcgccatggacctgcccatggtgagcggagatcgcatc
cactgcttggacatccttttcgccttcaccaagcgagtcctgggagacagtggggagttg
gacatcctgcggcagcagatggaggagcggttcgtggcatccaatccttccaaagtgtct
tacgagcctatcacaaccactctgcggcgcaagcaggaggaggtgtctgcagtggtcctg
cagcgtgcctacaggggacacttggctaggcggggcttcatctgcagaaagatggcctcc
aacaagctggagaatggaggcacacacagagacaagaaggagagcaccccgtccacagcc
tccctcccctcttacgacagcgtcacaaagccagacaaggagaagcagcagcgtgcggag
gagggcagaagggaaagagccaagaggcaaaaagaggtcagggagtccaagtgctag

DBGET integrated database retrieval system