KEGG   Rattus norvegicus (rat): 29716Help
Entry
29716             CDS       T01003                                 

Gene name
Cacna1d
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04218  Cellular senescence
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05031  Amphetamine addiction
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29716 (Cacna1d)
   04020 Calcium signaling pathway
    29716 (Cacna1d)
   04024 cAMP signaling pathway
    29716 (Cacna1d)
   04022 cGMP-PKG signaling pathway
    29716 (Cacna1d)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    29716 (Cacna1d)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    29716 (Cacna1d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    29716 (Cacna1d)
   04929 GnRH secretion
    29716 (Cacna1d)
   04912 GnRH signaling pathway
    29716 (Cacna1d)
   04921 Oxytocin signaling pathway
    29716 (Cacna1d)
   04935 Growth hormone synthesis, secretion and action
    29716 (Cacna1d)
   04924 Renin secretion
    29716 (Cacna1d)
   04925 Aldosterone synthesis and secretion
    29716 (Cacna1d)
   04927 Cortisol synthesis and secretion
    29716 (Cacna1d)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29716 (Cacna1d)
   04261 Adrenergic signaling in cardiomyocytes
    29716 (Cacna1d)
   04270 Vascular smooth muscle contraction
    29716 (Cacna1d)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    29716 (Cacna1d)
  09156 Nervous system
   04724 Glutamatergic synapse
    29716 (Cacna1d)
   04727 GABAergic synapse
    29716 (Cacna1d)
   04725 Cholinergic synapse
    29716 (Cacna1d)
   04728 Dopaminergic synapse
    29716 (Cacna1d)
   04726 Serotonergic synapse
    29716 (Cacna1d)
   04723 Retrograde endocannabinoid signaling
    29716 (Cacna1d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    29716 (Cacna1d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29716 (Cacna1d)
  09165 Substance dependence
   05031 Amphetamine addiction
    29716 (Cacna1d)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    29716 (Cacna1d)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    29716 (Cacna1d)
   05414 Dilated cardiomyopathy (DCM)
    29716 (Cacna1d)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    29716 (Cacna1d)
   04934 Cushing syndrome
    29716 (Cacna1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29716 (Cacna1d)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   29716 (Cacna1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 29716
NCBI-ProteinID: NP_058994
RGD: 70973
Ensembl: ENSRNOG00000013147
UniProt: P27732
Structure
PDB: 

Position
16p16
AA seq 2203 aa AA seqDB search
MMMMMMMKKMQHQRQQQEDHANEANYARGTRLPISGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVDWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IASGLLLHPNASVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCAANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEGETQGCCGSLWCWWKRRGAAKTGPSGCRRWGQAISKSKLRSHGAREALCVCRCSLESL
VKLWTSRFSAHLQAAYVRPYSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTIS
SEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITE
TILVELELMSPLGVSVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFI
IIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGP
SSSGMIVCIYFIILFICGNYILLKLFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKE
SLENKKNNKPEVNQIANSDNKVTIDDYQEEAEDKDPYPPCDVPVGEEEEEEEEDEPEVPA
GPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSA
ALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDML
VVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIV
TTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSD
FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAF
FMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYV
VNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKP
KGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGEGI
RTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAV
LLLFRCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLII
NLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPL
GFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAV
IKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNT
TIALQAGLRTLHDIGPEIRRAISCDLQDDEPEDSKPEEEDVFKRNGALLGNYVNHVNSDR
RESLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNAN
LNNANMSKAAHGKRPSIGDLEHVSENGHYSYKHDRELQRRSSIKRTRYYETYIRSESGDE
QLPTIFREDPEIHGYFRDPRCFGEQEYFSSEECCEDDSSPTWSRQNYSYYNRYPGSSMDF
ERPRGYHHPQGFLEDDDSPIGYDSRRSPRRRLLPPTPPSHRRSSFNFECLRRQNSQDDVL
PSPALPHRAALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYT
PLIQVDRSESMDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSA
DSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGSVCPRANGD
MGPISHRQDYELQDFGPGYSDEEPDPGREEEDLADEMICITTL
NT seq 6612 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcagcatcaacggcagcagcaagaggaccac
gcgaacgaggcaaactatgcaagaggcaccagactccctatttctggtgaaggaccaact
tctcagccgaacagctccaagcaaaccgtcctgtcttggcaagctgcaattgatgctgct
agacaggccaaggccgcccagaccatgagcacgtctgcacccccacctgtaggatctctc
tcccaaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtctaacagc
cgacctgcccgtgccctcttctgtttatccctcaataaccccatccgaagagcctgcatt
agtatagtggattggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccgttccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtggagacatttctgaagatt
atagcgtccggactgctgctgcatcctaatgcttccgttaggaacggatggaacttactg
gattttgttatagtaatagtaggattgtttagtgtaattttggaacaattaaccaaagaa
acagaaggcgggaaccactctagtggcaaatcaggaggctttgatgtcaaagccctccgt
gccttccgagtgttaagaccgcttcgacttgtatcaggagtgcccagtttacaagttgtt
ctgaactccattataaaagccatggtccccctcctccacatagcccttttggtgttattc
gtaattatcatctatgcgattatagggttggaactttttattggaaaaatgcacaaaacc
tgtttttttgctgactcagatatagtagctgaagaggacccagctccatgcgcgttctca
gggaatggacgccagtgtgccgccaatggcacggaatgtaggagcggctgggtcggcccc
aatggaggcatcactaattttgacaactttgcctttgccatgctcactgtgttccagtgc
atcaccatggagggctggacagatgtgctctactgggttaatgatgcgataggatgggag
tggccatgggtgtattttgttagtctgatcatccttggctcatttttcgtccttaacctg
gttcttggtgtccttagtggagaattctcaaaggaaagagagaaggctaaagcacgtgga
gatttccagaagcttcgggagaagcagcagctggaagaggatctcaagggctacttggac
tggatcacccaggcagaagacatagatcctgagaatgaagaggagggtggagaggagggc
aaacgaaacactagcatgcccaccagtgagaccgaatctgtgaacacagagaacgtaagt
ggtgaaggcgagacccagggatgctgtggaagtctctggtgctggtggaaaagaagaggc
gcggccaagactgggccctctgggtgtcggcggtggggccaagccatctcgaaatccaag
ctcagatcgcacggggcccgcgaggctttgtgtgtgtgccggtgcagccttgaatctctc
gtgaaactatggacgtctaggttctcagcccacttgcaggctgcatatgtcagaccctac
agccgtcggtggcgtcgctggaaccggttcaatcgcaggagatgcagggcagctgtgaag
tctgtcacgttttactggctggtgatcgttctggtgtttctcaacactctgacgatttcc
tctgagcactacaatcagccagactggctgacgcagattcaagatatagcgaacaaagtg
ctcttggctttgttcacctgtgagatgctggtgaagatgtacagcctgggcctccaggcc
tacttcgtctctctcttcaaccgcttcgattgctttgtggtgtgtgggggaatcaccgaa
accatcctggtggaactggagctcatgtctcccctgggcgtctctgtgttccggtgtgta
cgtctcctgaggatcttcaaagtgaccaggcactggacttccctgagcaacttggtggcg
tccctgttaaactccatgaagtccatcgcctctctgctgttgctgctcttcctcttcatc
atcatcttctccctgctggggatgcagctgttcggagggaagttcaatttcgatgagaca
cagaccaagcgaagcaccttcgacaacttcccacaggcgctcctgactgtgttccagatc
ctgacgggcgaagactggaatgcggtgatgtatgacggcatcatggcctacggaggcccg
tcctcctctggaatgattgtctgtatttacttcatcatccttttcatctgtggtaactat
atcctgctgaagctcttcttggccattgctgtagacaatttggctgatgctgaaagtctg
aacactgctcagaaagaggaagccgaagaaaaagaaaggaaaaaaattgccagaaaagaa
agcctagaaaacaaaaaaaacaacaaaccagaggtcaaccagatagccaacagtgacaac
aaggttactattgatgactatcaagaggaggctgaagataaggacccttatccaccctgc
gatgtgccagtaggtgaagaggaagaggaggaggaagaggacgagcctgaggttcctgct
ggtccccgtcctcgaagaatctcagagttgaacatgaaggagaaaattgcgcccatcccc
gaaggaagcgcattcttcattcttagcaagaccaacccgatccgtgtgggttgccacaaa
ctcatcaaccaccacatcttcaccaacctcatcctggtcttcatcatgctgagcagcgct
gccctggccgcagaggatcccatccgcagccactccttccgcaacactatactgggctac
tttgactatgctttcacagccatctttacggttgaaatcctgttaaagatgacaactttt
ggagcgttcttgcacaaaggggctttctgtaggaactacttcaatttgctggacatgctg
gtcgttggggtgtctctggtgtcatttgggattcaatccagtgccatctcggttgtgaag
attctgagggtcttaagggtcttgaggcctctcagagcaatcaacagagcaaaaggactt
aagcacgtggtccagtgtgtctttgtggccatccgaaccatcggcaacatcatgatcgtc
acgaccctgctccagttcatgtttgcttgcattggggtccagctgttcaaggggaagttc
taccgttgcacagatgaggccaaaagtaaccccgaggagtgcagggggcttttcatcctt
tataaggacggcgatgtcgacagtcccgtggtccgtgagaggatctggcaaaacagtgat
ttcaatttcgacaatgtcctttcggctatgatggcgctcttcacggtctcgacttttgag
ggctggcccgcgttgctgtacaaagctatcgactcaaacggagagaacgttggtcctgtc
tacaactaccgtgtggagatctccatcttcttcattatctacatcatcatcgtggccttc
ttcatgatgaatatcttcgtgggcttcgtcatcgtcaccttccaggagcagggagaaaag
gagtataagaactgtgagctggacaaaaatcagcgtcagtgtgtggaatatgccttgaag
gcccgccccttaaggagatacatccccaaaaacccataccagtacaagttctggtacgtg
gtgaactcctcgcctttcgaatatatgatgtttgtcctcatcatgctcaacacgctctgc
ctggccatgcagcactatgagcaatccaagatgttcaatgacgccatggacattctgaac
atggtcttcacgggggtcttcaccgttgagatggttttgaaagtcatcgcatttaagccc
aaggggtattttagtgacgcctggaacacgtttgactccctcatcgtaatcggcagcatt
atagacgtggcactcagcgaagctgacaactctgaagagagcaatagaatctccatcacc
tttttccgtcttttccgagtgatgcggttggtgaagcttctcagcagaggggaaggcatc
cggactctgctatggaccttcattaagtccttccaggcactcccatatgtcgccctcctc
attgccatgctcttcttcatctacgccgtcattggcatgcagatgtttgggaaggttgcc
atgagagataacaaccagatcaataggaacaacaacttccagacgtttccccaggcagtg
ctgctgctcttcaggtgtgcaacaggggaggcctggcaggagatcatgctcgcctgcctc
cctgggaagctgtgtgacccggactcagattacaacccaggagaggaatatacttgtggg
agcaactttgccattgtctacttcatcagcttttacatgctctgtgcgttcctgatcatc
aacctcttcgtggctgtcatcatggacaattttgactatctgacgagggactggtctatt
ctggggcctcaccacttggacgaattcaaaagaatatggtctgaatatgaccccgaggca
aagggaaggataaaacaccttgatgtggtcactttgctccgacgtatccagcctcccctg
ggatttggaaagttgtgtccacaccgagtggcgtgtaagagattggtcgccatgaacatg
cctctcaacagtgatgggacagtcatgttcaatgcaactctgtttgctttggtacggacg
gctctcaagatcaagactgaaggcaacctggagcaagctaatgaagagctccgcgctgtg
ataaagaaaatctggaagaagacaagcatgaagctacttgaccaagttgtccctccagct
ggtgatgatgaggtaaccgtggggaagttctatgccactttcctgatacaggactacttt
aggaaattcaagaagcggaaagagcaaggcctggtggggaaataccctgcgaagaacacc
acgatcgccctacaggcgggattaaggaccctgcatgacattgggccagaaatccgacgg
gctatatcctgtgacttgcaagatgacgaaccagaagactccaaaccagaagaggaagat
gtattcaaaagaaatggtgccctgcttggaaactatgtcaatcatgttaatagtgatagg
agagagtcccttcagcagaccaataccacccaccgtcccctgcatgtccaaaggccttca
attccacctgcaagtgatactgagaaaccgctgtttcctccagcaggaaattcggtgtgt
cataaccatcataaccataattccatagggaagcaagttcccacctccacaaatgccaat
ctcaataacgccaatatgtccaaagctgcccacggaaagcggcccagcattggggacctt
gagcatgtgtctgaaaacggccattactcctacaagcacgaccgagagcttcaaagaagg
tccagtattaaaagaacccgctattatgaaacttacattaggtctgagtcaggagacgag
cagcttccaaccattttccgtgaagaccctgagatacacggctacttccgagacccccgc
tgcttcggggagcaggaatatttcagtagcgaggagtgctgtgaggatgacagttctccc
acctggagcaggcaaaactacagctattacaacaggtacccaggcagctccatggacttt
gagaggccccgaggctaccatcacccccaaggtttcttagaagatgacgactctcccatt
ggctatgactcacggagatctccaagaagacgccttctacctcctaccccaccatcccat
cggaggtcctccttcaactttgagtgtctgcgcaggcaaaacagccaagatgacgtcctt
ccgtcgcctgccctgcctcaccgcgctgccctgcccctgcaccttatgcagcagcagatc
atggccgttgcaggcctagattccagtaaagcccagaagtactcgccgagccactctacc
cggtcatgggccacccctccagcaacccctccgtaccgagactggaccccatgctacacc
cctttgatccaggtggatcgctcagagtctatggaccaggtcaatggcagcctgccgtcg
ctacaccgcagttcctggtatacagatgaacccgacatctcctataggactttcacaccg
gccagcctgaccgtccccagcagcttccggaacaaaaacagcgacaagcagaggagtgca
gacagcctggtggaagcagtcctgatatccgaaggcttgggacgctacgcaagggaccca
aaatttgtctcagcaacaaaacatgagatcgccgatgcctgtgacctaaccatagacgag
atggagagcgcggccagcaccctgctcaatggaagcgtgtgtcctcgagccaacggggac
atgggccccatctcacaccgccaggactatgagctccaggactttggtcctggctacagt
gacgaggaaccagaccctgggcgagaggaagaggacctggcagatgaaatgatttgcatc
accaccttgtag

DBGET integrated database retrieval system