KEGG   Rattus norvegicus (rat): 29717
Entry
29717             CDS       T01003                                 

Gene name
Cacna1g
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1G isoform 1
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04713  Circadian entrainment
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29717 (Cacna1g)
   04020 Calcium signaling pathway
    29717 (Cacna1g)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    29717 (Cacna1g)
   04925 Aldosterone synthesis and secretion
    29717 (Cacna1g)
   04927 Cortisol synthesis and secretion
    29717 (Cacna1g)
  09159 Environmental adaptation
   04713 Circadian entrainment
    29717 (Cacna1g)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    29717 (Cacna1g)
   04934 Cushing syndrome
    29717 (Cacna1g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29717 (Cacna1g)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   29717 (Cacna1g)
SSDB
Motif
Pfam: Ion_trans PKD_channel SieB
Other DBs
NCBI-GeneID: 29717
NCBI-ProteinID: NP_001295231
RGD: 68942
Ensembl: ENSRNOG00000060528
Position
10
AA seq 2289 aa
MDEEEDGAGAEESGQPRSFTQLNDLSGAGGRQGPGSTEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERVSMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLEPYYQTENEDESPFICSQPRENGMRSCRSVPTLRGEGGGGPPCSL
DYETYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAIGVRAGLLSSPVARSGQEPQPSG
SCTRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRVPRASPEIQDRDANGSRRLMLPPPSTP
TPSGGPPRGAESVHSFYHADCHLEPVRCQAPPPRCPSEASGRTVGSGKVYPTVHTSPPPE
ILKDKALVEVAPSPGPPTLTSFNIPPGPFSSMHKLLETQSTGACHSSCKISSPCSKADSG
ACGPDSCPYCARTGAGEPESADHVMPDSDSEAVYEFTQDAQHSDLRDPHSRRRQRSLGPD
AEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISN
IVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLM
RVLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDT
LPDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLL
VAILVEGFQAEEIGKREDASGQLSCIQLPVNSQGGDATKSESEPDFFSPSVDGDGDRKKR
LALVALGEHAELRKSLLPPLIIHTAATPMSLPKSSSTGVGEALGSGSRRTSSSGSAEPGA
AHHEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQE
SQDEEESSEEDRASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRSSASEHQD
CNGKSASGRLARTLRTDDPQLDGDDDNDEGNLSKGERIQAWVRSRLPACCRERDSWSAYI
FPPQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFT
AVFLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLR
VLRLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKF
FVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDA
VGVDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEK
RLRRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFIT
GVIGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFCPLSQFSNLWAFGFRRFFQDRWNQ
LDLAIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVM
QALPQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFR
VSTGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEES
NKEAKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGVNSPDSPKPGAPHTTAHIGA
ASGFSLEHPTMVPHPEEVPVPLGPDLLTVRKSGVSRTHSLPNDSYMCRNGSTAERSLGHR
GWGLPKAQSGSILSVHSQPADTSCILQLPKDVHYLLQPHGAPTWGAIPKLPPPGRSPLAQ
RPLRRQAAIRTDSLDVQGLGSREDLLSEVSGPSCPLTRSSSFWGGSSIQVQQRSGIQSKV
SKHIRLPAPCPGLEPSWAKDPPETRSSLELDTELSWISGDLLPSSQEEPLSPRDLKKCYS
VETQSCRRRPGSWLDEQRRHSIAVSCLDSGSQPRLCPSPSSLGGQPLGGPGSRPKKKLSP
PSISIDPPESQGSRPPCSPGVCLRRRAPASDSKDPSVSSPLDSTAASPSPKKDTLSLSGL
SSDPTDMDP
NT seq 6870 nt   +upstreamnt  +downstreamnt
atggacgaggaggaggatggagcgggcgccgaggagtcgggacagccccgtagcttcacg
cagctcaacgacctgtccggggccgggggccggcaggggccggggtcgacggaaaaggac
ccgggcagcgcggactccgaggcggaggggctgccgtacccggcgctagccccggtggtt
ttcttctacttgagccaggacagccgcccgcggagctggtgtctccgcacggtctgtaac
ccgtggttcgagcgagtcagtatgctggtcattcttctcaactgtgtgactctgggtatg
ttcaggccgtgtgaggacattgcctgtgactcccagcgctgccggatcctgcaggccttc
gatgacttcatctttgccttctttgctgtggaaatggtggtgaagatggtggccttgggc
atctttgggaagaaatgttacctgggagacacttggaaccggcttgactttttcattgtc
attgcagggatgctggagtattcgctggacctgcagaacgtcagcttctccgcagtcagg
acagtccgtgtgctgcgaccgctcagggccattaaccgggtgcccagcatgcgcattctc
gtcacattactgctggacaccttgcctatgctgggcaacgtcctgctgctctgtttcttc
gtctttttcatctttggcatcgtgggcgtccagctgtgggcaggactgcttcgcaaccga
tgcttcctccccgagaacttcagcctccccctgagcgtggacctggagccttattaccag
acagagaatgaggacgagagccccttcatctgctctcagcctcgggagaatggcatgaga
tcctgcaggagtgtgcccacactgcgtggggaaggcggtggtggcccaccctgcagtctg
gactatgagacctataacagttccagcaacaccacctgtgtcaactggaaccagtactat
accaactgctctgcgggcgagcacaaccccttcaaaggcgccatcaactttgacaacatt
ggctatgcctggatcgccatcttccaggtcatcacactggagggctgggtcgacatcatg
tacttcgtaatggacgctcactccttctacaacttcatctacttcattcttctcatcatc
gtgggctccttcttcatgatcaacctgtgcctggtggtgattgccacgcagttctccgag
accaaacagcgggagagtcagctgatgcgggagcagcgtgtacgattcctgtccaatgct
agcaccctggcaagcttctctgagccaggcagctgctatgaggagctactcaagtacctg
gtgtacatcctccgaaaagcagcccgaaggctggcccaggtctctagggctataggcgtg
cgggctgggctgctcagcagcccagtggcccgtagtgggcaggagccccagcccagtggc
agctgcactcgctcacaccgtcgtctgtctgtccaccacctggtccaccaccatcaccac
caccatcaccactaccacctgggtaatgggacgctcagagttccccgggccagcccagag
atccaggacagggatgccaatgggtctcgccggctcatgctaccaccaccctctacaccc
actccctctgggggccctccgaggggtgcggagtctgtacacagcttctaccatgctgac
tgccacttggagccagtccgttgccaggcaccccctcccagatgcccatcggaggcatct
ggtaggactgtgggtagtgggaaggtgtaccccactgtgcataccagccctccaccagag
atactgaaggataaagcactagtggaggtggcccccagccctgggccccccaccctcacc
agcttcaacatcccacctgggcccttcagctccatgcacaagctcctggagacacagagt
acgggagcctgccatagctcctgcaaaatctccagcccttgctccaaggcagacagtgga
gcctgcgggccggacagttgtccctactgtgcccggacaggagcaggagagccagagtcc
gctgaccatgtcatgcctgactcagacagcgaggctgtgtatgagttcacacaggacgct
cagcacagtgacctccgggatccccacagccggcggcgacagcggagcctgggcccagat
gcagagcctagttctgtgctggctttctggaggctgatctgtgacacattccggaagatc
gtagatagcaaatactttggccggggaatcatgatcgccatcctggtcaatacactcagc
atgggcatcgagtaccacgagcagcccgaggagctcaccaacgccctggaaatcagcaac
atcgtcttcaccagcctcttcgccttggagatgctgctgaaactgcttgtctacggtccc
tttggctacattaagaatccctacaacatctttgatggtgtcattgtggtcatcagtgtg
tgggagattgtgggccagcagggaggtggcctgtcggtgctgcggaccttccgcctgatg
cgggtgctgaagctggtgcgcttcctgccggccctgcagcgccagctcgtggtgctcatg
aagaccatggacaacgtggccaccttctgcatgctcctcatgctgttcatcttcatcttc
agcatcctgggcatgcatctctttggttgcaagttcgcatctgaacgggatggggacacg
ttgccagaccggaagaatttcgactccctgctctgggccatcgtcactgtctttcagatt
ctgactcaggaagactggaataaagtcctctacaacggcatggcctccacatcgtcttgg
gctgctctttacttcatcgccctcatgacttttggcaactatgtgctctttaacctgctg
gtggccattcttgtggaaggcttccaggcagaggaaatcggcaaacgggaagatgcgagt
ggacagttaagctgtattcagctgcctgtcaactctcaggggggagatgccaccaagtct
gagtcagagcctgatttcttttcgcccagtgtggatggtgatggggacagaaagaagcgc
ttggccctggtggctttgggagaacacgcggaactacgaaagagccttttgccacccctc
atcatccatacggctgcgacaccaatgtcactacccaagagctccagcacaggtgtgggg
gaagcactgggctctggctctcgacgtaccagtagcagtgggtccgctgagcctggagct
gcccaccatgagatgaaatctccgccaagtgcccgcagctccccgcacagtccctggagt
gcggcaagcagctggaccagcaggcgctccagcaggaacagcctgggccgggcccccagc
ctaaagcggaggagcccgagcggggagcggaggtccctgctgtctggagagggccaggag
agtcaggatgaggaggaaagttcagaagaggaccgggccagcccagcaggcagtgaccat
cgccacaggggttccttggaacgtgaggccaagagttcctttgacctgcctgacactctg
caggtgccggggctgcaccgcacagccagcggccggagctctgcctctgagcaccaagac
tgtaatggcaagtcggcttcagggcgtttggcccgcaccctgaggactgatgacccccaa
ctggatggggatgatgacaatgatgagggaaatctgagcaaaggggaacgcatacaagcc
tgggtcagatcccggcttcctgcctgttgccgagagcgagattcctggtcggcctatatc
tttcctcctcagtcaaggtttcgtctcctgtgtcaccggatcatcacccacaagatgttt
gaccatgtggtcctcgtcatcatcttcctcaactgtatcaccatcgctatggagcgcccc
aaaattgacccccacagcgctgagcgcatcttcctgaccctctccaactacatcttcacg
gcagtctttctagctgaaatgacagtgaaggtggtggcactgggctggtgctttggggag
caggcctacctgcgcagcagctggaatgtgctggacggcttgctggtgctcatctccgtc
atcgacatcctggtctccatggtctccgacagcggcaccaagatccttggcatgctgagg
gtgctgcggctgctgcggaccctgcgtccactcagggtcatcagccgggcccagggactg
aagctggtggtagagactctgatgtcatccctcaaacccattggcaacattgtggtcatt
tgctgtgccttcttcatcatttttggaattctcggggtgcagctcttcaaagggaagttc
ttcgtgtgtcagggtgaggacaccaggaacatcactaacaaatccgactgcgctgaggcc
agctaccgatgggtccggcacaagtacaactttgacaacctgggccaggctctgatgtcc
ctgtttgtgctggcctccaaggatggttgggttgacatcatgtatgatgggctggatgct
gtgggtgtggatcagcagcccatcatgaaccacaacccctggatgctgctatacttcatc
tccttcctcctcatcgtggccttctttgtcctgaacatgtttgtgggcgtggtggtggag
aacttccataagtgcagacagcaccaggaggaggaggaggcgaggcggcgtgaggagaag
cgactacggaggctggagaaaaagagaaggaatctaatgttggacgatgtaattgcttcc
ggcagctcagccagcgctgcgtcagaagcccagtgcaagccctactactctgactactcg
agattccggctccttgtccaccacctgtgtaccagccactacctggacctcttcatcact
ggtgtcatcgggctgaacgtggtcactatggccatggaacattaccagcagccccagatc
ctggacgaggctctgaagatctgcaattacatctttaccgtcatcttttgtcctttgagt
cagttttcaaacttgtgggcctttggcttccgccgtttcttccaggacaggtggaaccag
ctggacctggctattgtgcttctgtccatcatgggcatcacactggaggagattgaggtc
aatgcttcgctgcccatcaaccccaccatcatccgtatcatgagggtgctccgcattgct
cgagttctgaagctgttgaagatggctgtgggcatgcgggcactgctggacacggtgatg
caggccctgccccaggtggggaacctgggacttctcttcatgttattgtttttcatcttt
gcagctctgggcgtggagctctttggagacctggagtgtgatgagacacacccttgtgag
ggcttgggtcggcatgccacctttaggaactttggtatggcctttctgaccctcttccga
gtctccactggtgacaactggaatggtattatgaaggacaccctccgggactgtgaccag
gagtccacctgctacaacactgtcatctcccctatctactttgtgtccttcgtgctgacg
gcccagtttgtgctggtcaacgtggtcatagctgtgctgatgaagcacctggaagaaagc
aacaaagaggccaaggaggaggccgagctcgaggccgagctggagctggagatgaagacg
ctcagcccgcagccccactccccgctgggcagccccttcctctggcccggggtggagggt
gtcaacagtcctgacagccctaagcctggggctccacacaccactgcccacattggagca
gcctcgggcttctcccttgagcaccccacgatggtaccccaccccgaggaggtgccagtc
cccctaggaccagacctgctgactgtgaggaagtctggtgtcagccggacgcactctctg
cccaatgacagctacatgtgccgcaatgggagcactgctgagagatccctaggacacagg
ggctgggggctccccaaagcccagtcaggctccatcttgtccgttcactcccaaccagca
gacaccagctgcatcctacagcttcccaaagatgtgcactatctgctccagcctcatggg
gcccccacctggggcgccatccctaaactacccccacctggccgctcccctctggctcag
aggcctctcaggcgccaggcagcaataaggactgactccctggatgtgcagggcctgggt
agccgggaagacctgttgtcagaggtgagtgggccctcctgccctctgacccggtcctca
tccttctggggcgggtcgagcatccaggtgcagcagcgttccggcatccagagcaaagtc
tccaagcacatccgcctgccagccccttgcccaggcctggaacccagctgggccaaggac
cctccagagaccagaagcagcttagagctggacacggagctgagctggatttcaggagac
ctccttcccagcagccaggaagaacccctgtccccacgggacctgaagaagtgctacagt
gtagagacccagagctgcaggcgcaggcctgggtcctggctagatgaacagcggagacac
tccattgctgtcagctgtctggacagcggctcccaaccccgcctatgtccaagcccctca
agcctcgggggccaacctcttgggggtcctgggagccggcctaagaaaaaactcagccca
cccagtatctctatagaccccccggagagccagggctctcggcccccatgcagtcctggt
gtctgcctcaggaggagggcgccggccagtgactctaaggatccctcggtctccagcccc
cttgacagcacggctgcctcaccctccccaaagaaagacacgctgagtctctctggtttg
tcttctgacccaacagacatggacccctga

DBGET integrated database retrieval system