KEGG   Rattus norvegicus (rat): 297520
Entry
297520            CDS       T01003                                 

Gene name
Il17rc
Definition
(RefSeq) interleukin-17 receptor C precursor
  KO
K05166  interleukin 17 receptor C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    297520 (Il17rc)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    297520 (Il17rc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    297520 (Il17rc)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL17 receptor family
   297520 (Il17rc)
SSDB
Motif
Pfam: IL17_R_N SEFIR DUF6232
Other DBs
NCBI-GeneID: 297520
NCBI-ProteinID: NP_001164036
RGD: 1306392
Ensembl: ENSRNOG00000027376
UniProt: D3ZIM0
Position
4
AA seq 677 aa
MPVPWFLLSLALGRSPVVVSLERLMEPQDTAHCSLGLSCHLWDGDVLCLPGSIESAPGPV
LVPTRLQTELVLRCPQETDCALCVRVVVHLAVHGHWEEPEEAGKSDSELQGPRNASLQAQ
VVLSFQAYPIARCALLEVQVPADLVQPGQSVGSAVFDCFEAGLGAEVRIWSYTKPRYQKE
LNVTQQLPDCRGLEVQDSIQSCWALPWLNVSTDGDNVLLILDVSKEQKFGFLLYWDQAQG
PLKSLLYKNLTGPQNITLNHTDLVPCLCIQLWSQEPDSVRTSFCPFKKDPRAHRNLWHMA
RLRVQSSGSWLLDTPCSLRTEVALCWQAPDQSPCQPLVPPMPQKNVTMNRPFEFPLVKEH
PNLCVQVSSWEKVELQECLWADSLGPFKDDMLLVEMKTDLNDTSVCALEPSGCTPLPSVA
STRAARLGEQLLLDFRTHQCMQLWNDDDLGSLWACPMDKYIHKRWVLVWLACLLLAAALF
FFLLLKKDRRKAAPRARPALLLHSADGAYYERLVGALASALSQMPLRVAVDLWSRRELTA
HGALAWFHQQRRRTLQEDGVVILLFSPAAVAQCQQWLQLQTVEPGPHDALAAWLSCVLPD
FLQGQATGRYVGVYFDGLLHPDTVPALFRVAPLFSLPSQLPAFLDALQGSSSQSPGRPAD
RAERVAQALLSALDSCT
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgcctgtgccctggttcctgctgtccttggcactgggccgaagccccgtggtcgtttcc
ctggagagactcatggagcctcaggacactgcacactgctctctaggcctctcctgccac
ctctgggatggtgacgtgctctgcctgcctggaagcatcgagtctgccccaggccctgtg
ctagtgcctacccgcctgcagacggagctggtactcaggtgtccacaagagacagattgc
gccctctgtgtccgtgtggttgtacacttggctgtgcatgggcactgggaagagcccgaa
gaagctggaaagtctgattcagaactccaggggcctaggaacgcctctctccaggcccag
gtggtgctctcctttcaggcctaccccattgctcgctgtgccctgctggaggtccaggtg
cctgctgacctggtgcagcctggtcagtccgtgggttctgcagtatttgactgttttgag
gctggtcttggggctgaggtacgaatctggtcctacaccaaacccaggtaccagaaagaa
ctcaacgtcacgcagcagttgcctgactgcaggggtctcgaagtccaggacagcatccag
agctgctgggccctaccctggctcaatgtgtctacagatggtgacaatgttcttctgata
ctggacgtctctaaggagcagaaatttggcttcttactatactgggatcaggcccagggt
cctctcaaatccttgttgtacaaaaacctgactggacctcagaacattactttaaaccac
actgacctggttccctgcctctgcattcagttatggtctcaggagccagactctgttagg
accagcttctgccccttcaagaaagatccccgtgcacacaggaacctttggcacatggcc
aggctgcgggtgcagtcctcagggagctggctgctagacacgccttgctctctacggacc
gaggtggcactgtgctggcaggcaccagaccagagtccctgccagccccttgtgccacca
atgccccagaagaatgtcactatgaataggccatttgagttcccattggtgaaagaacac
cccaacctctgtgtccaggtgagcagctgggagaaggttgagctccaagagtgcttgtgg
gctgactccttagggcccttcaaggatgatatgctgttagtggagatgaaaactgaccta
aacgacacatcagtctgtgccttggaacccagtggctgtacaccactgcctagtgttgcc
tccacgagagctgctcgccttggagagcagttgcttctagacttcaggacacaccagtgc
atgcagctgtggaatgatgatgacctgggatcactgtgggcctgccccatggacaagtac
atccacaagcgctgggtcctagtgtggctggcctgcctactcttggctgcggcgcttttc
ttcttcctccttttaaaaaaggaccgcaggaaagcggcccctcgtgcccgcccggccctg
cttctccactcggccgatggagcatactacgagcgtctggtgggcgctctggcgtccgcg
ttgagccagatgccactgcgcgttgccgtggacctgtggagccgccgcgagctgaccgcg
cacggagccctggcctggttccaccagcaacggcgccggaccctgcaggaggatggcgtg
gtcatacttctcttctcacccgcggccgtggcgcagtgtcagcagtggctgcagctccag
acggtggagcccgggccgcatgacgctctggccgcctggctcagctgcgtgctgcccgat
ttcctgcaaggccaggcgaccggccgctacgtcggggtctactttgacgggctgctgcac
ccagacactgtacccgccctgttccgcgtcgcgccgctcttctccctgccctcgcagctg
ccggccttcctggatgcactgcagggaagcagctcccagtcccccgggcgacctgcggac
agggcggaacgagtggcccaggcgctgctgtccgccctagacagctgtacttag

DBGET integrated database retrieval system