KEGG   Rattus norvegicus (rat): 297554
Entry
297554            CDS       T01003                                 

Gene name
Csgalnact2, Galnact2, RGD1563660
Definition
(RefSeq) chondroitin sulfate N-acetylgalactosaminyltransferase 2
  KO
K00746  chondroitin sulfate N-acetylgalactosaminyltransferase 1/2 [EC:2.4.1.174 2.4.1.175]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
rno01100  Metabolic pathways
Module
rno_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    297554 (Csgalnact2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    297554 (Csgalnact2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.174  glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase
     297554 (Csgalnact2)
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     297554 (Csgalnact2)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   297554 (Csgalnact2)
SSDB
Motif
Pfam: CHGN Glyco_transf_7C Glyco_tranf_2_2 KfrA_N Csm1_N SlyX
Other DBs
NCBI-GeneID: 297554
NCBI-ProteinID: NP_001100086
RGD: 1563660
Ensembl: ENSRNOG00000014713
UniProt: D4A5Z0
Position
4q42
AA seq 542 aa
MSRRGPILHSRTQWLLVGLALLFSLVLFMYLLECAPQTDGNASLPGVVRENYGKEYYQAL
LQEQEEHYQTRATSLKRQIAQLKQELQDMSEKMRALQERKKLGANGIGYQGNREQTPSDL
LEFLHSQIDRAEVSIGAKLPSEYGVVPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRDEL
VEVIEAGLEVINNPDEDDEQEDEEGPLGEKLIFNENDFIEGYYRTERDKGTHYELFFKKA
DLMEYRHVTLFRPFGPLMKVKSELIDITRSVINIIVPLAERTEAFSQFMQNFRDVCIHQD
KRIHLTVVYFGKEGLSTVKSILESVSSESNFHNYTLVSLNEEFNRGRGLNVGARTWDKGE
VLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQEVPPPVEQQLVH
KKDSGFWRDFGFGMTCQYQSDFLSVGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPG
LFHLWHEKHCADELTPEQYRMCIQSKAMNEASHSHLGMMVFREEIEMHLRKQAYRTNSEA
AG
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgtctagaagaggaccgattcttcacagccggacccagtggctgctggtgggccttgct
ttgcttttcagtctagtattatttatgtacctcctggaatgtgccccccagactgatgga
aatgcttctctccctggtgtggttagagaaaattatggtaaagaatattaccaagccctc
ctgcaggagcaagaagaacattaccaaaccagggcaaccagtttgaaacgccagattgcc
cagctaaagcaagaactacaagatatgagtgagaagatgagagccttgcaagagaggaag
aagctaggggctaacggcataggctatcagggcaacagagagcagacacccagcgacctc
ttagagtttcttcattcccagatcgacagagctgaagtcagcataggggccaaactaccc
agtgagtatggagtcgttccctttgaaagttttactttaatgaaagtatttcagttggaa
atgggtctcacgcgccatcctgaagaaaagccagttagaaaagacaaacgagatgaattg
gtagaagttattgaagctggcttggaggtcattaataatcctgatgaagatgatgaacag
gaagatgaggagggcccccttggagagaaactgatatttaatgaaaatgacttcatagaa
ggctattaccgcactgagagagataaaggcacgcactatgagctgttttttaagaaggca
gaccttatggaatacaggcatgtgaccctcttccgccctttcggacctctcatgaaagtg
aagagcgagctgattgacattacaagatcggttattaatatcattgtgccgcttgctgag
aggacagaagccttttcacagtttatgcagaacttcagagatgtttgtattcatcaagac
aagagaattcatctcaccgttgtgtattttgggaaagaaggactatctacagtcaagtct
attctagaatctgtctcaagtgagtctaattttcacaattacaccttggtctcattgaac
gaagaatttaatcgtggacgaggactaaatgtgggtgcccgaacttgggacaagggagag
gtcttgatgtttttctgtgatgttgatatatatttctcagctgaattccttaacagctgc
cggttaaatgctgagccaggtaaaaaagtgttttaccccgtggtgttcagtctttacaac
cctgccatcgtctatgccaaccaggaagtgccacctcccgtggagcagcagctggttcat
aaaaaggactctggtttttggagagattttggctttgggatgacgtgtcaatatcaatca
gattttctgagtgtcggtggattcgacatggaagtaaaaggctggggtggagaagatgtt
catctttaccgaaagtacttacatggtgatcttattgtgattcggactccagttcctggc
cttttccacctctggcatgagaaacactgtgcggacgagctgacccctgagcaataccga
atgtgcatccaatccaaagccatgaacgaggcctctcactcccacctgggaatgatggtc
ttcagggaggaaatagagatgcacctccgcaaacaggcgtacagaaccaacagcgaggcc
gctgggtga

DBGET integrated database retrieval system