KEGG   Rattus norvegicus (rat): 29758
Entry
29758             CDS       T01003                                 

Gene name
St6galnac3
Definition
(RefSeq) alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
  KO
K03373  N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7C) [EC:2.4.99.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    29758 (St6galnac3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    29758 (St6galnac3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     29758 (St6galnac3)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   29758 (St6galnac3)
SSDB
Motif
Pfam: Glyco_transf_29 PIF
Other DBs
NCBI-GeneID: 29758
NCBI-ProteinID: NP_061996
RGD: 3677
Ensembl: ENSRNOG00000056894
Vega: OTTRNOG00000001190
UniProt: Q64686
Position
2
AA seq 305 aa
MACILKRKPALAVSFIALCILLLAMRLANDVTFPLLLNCFGQPKTKWIPLSYTLRQPLQT
HYGYINVRTQEPLQLNCNHCAVVSNSGQMVGQKVGEEIDRASCIWRMNNAPTKGFEEDVG
YMTMVRVVSHTSVPLLLKNPDYFFKEASTTIYVIWGPFRNMRKDGNGIVYNMLKKTVDTY
PDAQIYVTTEQRMTYCDGVFKDETGKDRVQSGSYLSTGWFTFILAMDACYSIHVYGMINE
TYCTTEGYRKVPYHYYEQGKDECNEYLLHEHAPYGGHRFITEKKVFAKWAKKHRIVFTHP
NWTVS
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcctgcatcctcaagaggaagcctgcgcttgcggtgagcttcatagccctgtgcatc
ttgctgctagccatgcgccttgccaatgacgtgactttccctttgctcctgaactgcttt
ggacaacctaaaaccaaatggatccctttgtcctacacactcaggcagcctcttcaaact
cactatggatacataaacgtgaggacccaagagcctttgcagctgaactgtaaccattgt
gccgtcgtgtcgaactcgggtcagatggttggacagaaggtgggggaagagatagaccgt
gcgtcctgcatctggagaatgaacaatgcccccaccaagggtttcgaggaagatgtcggc
tacatgacgatggtccgagtggtgtcacacaccagcgtccctctcttgctgaaaaacccg
gactattttttcaaggaggcgagcacaaccatttacgtcatctggggccctttccgcaac
atgaggaaggacgggaacgggatcgtgtacaacatgctaaagaagacggtcgacacctac
ccagacgcgcagatctacgtgaccacggagcagcggatgacgtactgcgacggggtgttt
aaggatgaaactgggaaagacagagtccagtctggctcctatctcagcaccgggtggttc
acctttatcctggccatggacgcctgctacagtatccacgtctacgggatgataaatgag
acctactgcacgacagaagggtatagaaaagtcccctatcattactatgaacaagggaag
gacgagtgtaacgagtatcttctccatgaacatgccccatacgggggacacaggttcatc
accgagaagaaagtgtttgccaagtgggccaagaaacacagaatagtatttacacaccca
aactggacagtgtcctga

DBGET integrated database retrieval system