KEGG   Rattus norvegicus (rat): 297989Help
Entry
297989            CDS       T01003                                 

Gene name
Ddx58
Definition
(RefSeq) DEXD/H-box helicase 58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    297989 (Ddx58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    297989 (Ddx58)
   04623 Cytosolic DNA-sensing pathway
    297989 (Ddx58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    297989 (Ddx58)
   05164 Influenza A
    297989 (Ddx58)
   05161 Hepatitis B
    297989 (Ddx58)
   05160 Hepatitis C
    297989 (Ddx58)
   05168 Herpes simplex virus 1 infection
    297989 (Ddx58)
   05169 Epstein-Barr virus infection
    297989 (Ddx58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    297989 (Ddx58)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     297989 (Ddx58)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   297989 (Ddx58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD_2 RIG-I_C ResIII DEAD AAA_22 AAA_25 zf-C2H2_aberr PhoH
Motif
Other DBs
NCBI-GeneID: 297989
NCBI-ProteinID: NP_001100115
RGD: 1309460
Ensembl: ENSRNOG00000006384
UniProt: D4ADT5
Position
5q22
AA seq 598 aa AA seqDB search
MTAEQRQNLQAFRDYIKKILDPTYILSYMSSWLRDDEVQCIQAEKNNKGPIEAASLFLRY
LLELQTEGWFRAFLDALYHAGYCGLYEAIETWDFQKLEKLEEHRLLLRRLEPEFKATVSP
TDILSEISECLINQECEEIRQICFTKGRMAGAEKMVQCLLRSDKENWPKVLQFALEKDNS
KFSELWLVDKGVRRVDCKAVEDDGTEMASIQIFIQEEPECQNLSQNPGPPSEASPNNSHS
PLKPRNYQLELALPAKKGKNTVICAPTGCGKTFVSLLICEHHLKNFPHGQKGKVVFFANQ
IPVYEQQATVFSRYFERFGYNVAGISGATADNVSVQHIIENNDIVILTPQILVNSLNNGA
IPSLSVFTLMIFDECHNTSKHHPYNQIMFRYLDHKLGGSPDPLPQVIGLTASVGVGDAKT
VEEAMLHICKLCAALDASVIATVRDNVEELEQVVYKPQKISRKVESRASNTFKCIISQLM
REAERLAKNVSEELGKFFQIQNREFGTQKYEQWIVAVHKACTVFQMPDKDEESRICKALF
LYTSHLRKYNDALIISEDAQMKDALNYLKAFFHDVREAAFDETEQDLTRRFEGFEEMD
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagagcagcggcagaatctgcaagcattcagagactatatcaagaagattctg
gaccccacctacatcctcagctatatgagttcctggctccgggatgatgaggtgcagtgc
attcaggccgagaagaacaacaagggcccaatagaggccgcctcactgttcctccggtac
ctgttggagctgcagacagagggctggttccgggcctttttggatgccctgtaccatgca
ggttactgtggactttatgaagccatcgaaacttgggactttcaaaaacttgaaaagtta
gaggaacacagattacttttaagacgtttagagccggaatttaaggccacagttagcccg
acagatatcctttctgaaatatctgaatgtttgattaatcaggaatgtgaagaaatcaga
cagatctgcttcactaaagggaggatggcgggtgcggagaagatggtccaatgtcttctc
agatccgataaggagaactggccaaaggttttgcagtttgctttggagaaagacaacagc
aagtttagtgaactgtggctcgtcgataaaggtgtcagaagggttgactgtaaggctgtt
gaggatgacggaacagagatggccagcatacagattttcattcaggaagaaccggagtgt
cagaatctcagtcagaatcccggccctccttcagaagcgtctcctaataattcacacagc
ccattgaaaccaagaaattaccaactggagcttgccctgcctgccaagaaagggaaaaat
acagtaatatgtgctcctactggttgtggaaaaacctttgtgtcgcttctcatatgcgaa
catcatcttaaaaactttccgcacggacagaaagggaaagtggtcttttttgctaaccag
atccctgtgtatgaacagcaggccactgtgttctcacgatatttcgaaagatttgggtac
aatgtcgccggcatttcgggggcaacggctgataatgtgtcagtgcagcacatcattgaa
aacaatgacatcgtcatcctgacaccccagattcttgtgaacagtctcaacaatggagcc
atcccctcgctgtctgtcttcactctgatgatattcgacgagtgtcataacaccagcaaa
caccacccgtacaaccagatcatgttcagatacctagatcacaaactcggagggtcaccc
gacccactgcctcaggtcattgggctgactgcttccgttggtgttggagatgctaaaacc
gtggaggaagccatgctgcacatctgcaaactctgtgccgccctcgatgcctcagtgatt
gccacagtcagagacaacgtggaagaactggagcaggttgtttataagcctcagaaaatt
tccaggaaagtggaatcacgggcttcgaacacgtttaaatgcatcatatctcagctgatg
agggaggcagagaggctggcgaagaacgtctctgaggaacttggaaagttctttcaaatt
caaaatcgagaatttggcacccagaaatatgagcagtggattgtcgccgttcacaaagca
tgcacggtgtttcagatgcctgacaaagatgaggagagcaggatctgcaaggcgctcttt
ctgtacacctcccacttgcggaaatacaacgacgccctcatcatcagcgaggatgcacag
atgaaagacgctctaaattacctcaaagccttcttccatgatgtccgagaagcagcattt
gatgagactgagcaagatcttacgcggaggtttgaaggctttgaagaaatggattga

DBGET integrated database retrieval system