KEGG   Rattus norvegicus (rat): 298069
Entry
298069            CDS       T01003                                 

Gene name
Col15a1
Definition
(RefSeq) collagen type XV alpha 1 chain
  KO
K08135  collagen type XV alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    298069 (Col15a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    298069 (Col15a1)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   298069 (Col15a1)
SSDB
Motif
Pfam: Endostatin Collagen Laminin_G_3 Laminin_G_2 DUF4129
Other DBs
NCBI-GeneID: 298069
NCBI-ProteinID: NP_001094005
RGD: 1310820
Ensembl: ENSRNOG00000060381
UniProt: A0A0G2JV12
Position
5q22
AA seq 1345 aa
MTHRRTAQGRRPRWLLSIISTLLSTVLQTRAATGSASQDHLDLTELIGVPLPSSVSFVTG
YGGFPAYSFRPGANVGRPARTLIPSTFFRDFAIGVAVKPSSAQGGVLFAVTDAFQKVIYL
GLRLSRVEDGRQRVILYYTEPGSHVSQEAAAFSVPVMTNRWNRFAVTVQGEEAVLFMDCE
EHSQVLFQRSSRPLTFEPSAGIFVGNAGATGLERFTGSIQQLIIYSDPRTPEELCEAQES
SASGEASGFQEMDEVAEIMEAVTYTQAPPKEAHVDPISMPPTSSSPTEDTELSGEPVPEG
TPGTDLSITGHSSPEQGSGEILNDTLEVRTVDGNPSTDGGSGDGALLNVTDGQGLSATAT
GETRVPVTTALEVENGSMPTGSPTLAMFTQSFREVDMLDLENLTTASGDGEVPTSTDVDT
EAGTLPTGGPTLKPREEATLGSLGEEWSTTVVSKVPLNAFEEEEASGTAIDSLDAFTPTV
VLEQASGTPTDIQAALTTTVAPEQVFTAAPTDGEDLVTSTEESDEEGSGSTLPIGPPLSK
PTVTPERQVTLAGVEAEGSDPVWGVDVGSGSGDIVGNEDLLRGPPGPPGPPGSPGIPGKP
GTDVFVGPPGSPGEDGAPGEPGPQGPEGQPGLDGASGQPGMKGEKGARGPNGSVGEKGDP
GSRGLPGPPGKNGEVGIPGAMGPPGPPGPPGPPGPGCTTKLGFEIEGSGDTQLLSKPRIS
GPSSPSGPKGEKGEQGAKGERGTDGISTMGPPGPRGPPGRVEVLSSSLINITNGSMNFSD
IPELMGPPGPDGVPGLPGFPGPRGPKGDTGVPGFPGLKGEQGEKGEPGAILTGDIPLEMV
KGRKGEPGVHGAPGPMGPKGPPGHKGEFGLPGRPGRPGLNGLKGAKGDRGIMLPGPPGLP
GPPGPPGPPGAVVNIKGAVFPIPARPHCKTPVGTAHPGDPELVTFHGVKGEKGSWGLPGT
KGEKGDQGAQGPPGPPVDPAYLRHFLNSLKGENGDAAFRGESSHNLFVSGPPGLPGHPGL
AGQKGEAVVGPQGPPGIPGLPGPPGFGRPGVPGPPGPPGPPGPPAILGAAVPLPGPPGPP
GQPGLPGSRNLVTALSDMGDMLQKAHLVIEGTFIYLRESGEFFLRVRDGWKKLQLGELIP
IPADSPPPPALSSNPYQPQPPLNPILSANYERPVLHLVALNTPVAGDIRADFQCFQQARA
AGLLSTFRAFLSSHLQDLSTVVRKAERFSLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIP
IYSFDGRDVMTDPSWPQKVVWHGSNPHGVRLVDKYCEAWRTTDMAVTGFASPLSTGKILD
QKAYSCANRLIVLCIENSFMTDARK
NT seq 4038 nt   +upstreamnt  +downstreamnt
atgacacacaggaggaccgcgcagggccggcgcccgaggtggctgctctccatcatctcc
acgctgctttccaccgtcctgcagacgcgcgccgcgacagggtcagcctctcaggaccac
ctggacctcacagagctcattggtgtcccattaccctcatctgtgtcctttgtcaccggc
tatggtggtttcccggcttacagcttccggcctggggccaatgtcggccgcccagccagg
accctcatcccatcgaccttcttcagggatttcgccatcggtgtggcagtgaagcccagt
agtgcccaagggggcgtgcttttcgctgttactgatgctttccagaaagtcatctacctg
ggcctgcggctttcccgtgtagaggacggccgccagcgggttatcctctactacacggaa
cccggctcccacgtgtcccaggaggctgctgctttctcggtgcccgtaatgactaacagg
tggaatcgctttgctgtgaccgtccagggcgaggaagcggtccttttcatggactgtgag
gaacacagccaagtccttttccagcgatcttcccggccgttgacttttgagcccagtgcc
gggatctttgtgggcaacgcaggagccaccggcctggagagatttacgggctccatacaa
cagctcatcatctattcagaccccaggacccctgaggagctgtgtgaagcacaagagtcc
tcggcatctggagaagccagtgggtttcaggagatggatgaagttgctgaaatcatggaa
gccgtcacttacacacaagccccgcctaaagaagcacacgttgatcccataagcatgccc
cctacttcatcctctcctactgaggacacagagctttctggggaaccggttccagaagga
accccaggaactgacctgagcatcactggacacagcagccctgagcaagggtctggtgaa
atcctgaatgataccctggaggtccgtactgtggatgggaaccccagtactgatggtggt
tcaggggatggggccttgctgaacgtcactgacggtcaggggttatcagcaacagcaact
ggggagaccagggtgcctgtcaccactgccctggaagtagagaatggcagtatgcccact
gggagccccaccctggccatgtttacccagagcttcagggaagtagacatgctggatcta
gaaaatctaacaacagcatcaggggatggtgaggtgcctaccagcactgatgtggacaca
gaggctggcactttgcccactggagggccaaccctgaagccaagagaagaggccactctg
ggttcactcggtgaagaatggtcaaccacagttgtgtccaaagtgcccctcaatgccttt
gaggaagaggaagccagcgggactgccatcgacagcctggatgccttcacacccacagtg
gtccttgagcaagccagcgggacccctacagacattcaggctgctctcaccaccacagtg
gcccctgagcaagtgtttactgctgcacccacagatggagaagacctggtgacttctaca
gaggaatctgacgaggagggatctggtagcaccctccccatagggcccccgctctccaaa
cccacagtgactccagagaggcaggtcaccctggcaggagtggaggccgaggggtcagac
cctgtttggggcgtggacgtgggctcaggctctggagacattgtgggcaatgaagatctg
ttgagaggtcctccaggtcccccaggcccaccgggatcacctgggattccagggaaacca
ggaactgatgttttcgtgggacctcctgggtctcctggagaggatggagctcctggtgag
ccaggaccccagggccctgagggacagcctggacttgatggagcctctggccagcctgga
atgaaaggagagaagggagcaagaggacctaacggctccgttggcgagaagggcgaccct
ggcagccgaggcttaccagggcccccagggaagaacggagaagttggtatccctggggcc
atgggaccgccggggcctcctggaccccctgggcctccaggtccgggatgtacaaccaag
cttggatttgagattgaaggctctggggacacccagctgctgagcaaacccagaatctcg
ggaccctcctctccaagtggtcccaaaggagaaaaaggagaacaaggagccaagggtgaa
cgggggacagacggaatcagcactatggggcctcctgggcccagggggccacctggacgt
gttgaggtcctgtccagttctttgatcaacatcaccaatggatccatgaatttctcagac
attcctgagctcatggggcctccggggccagacggtgtgccggggctgccagggtttcca
ggccccagaggaccaaaaggtgacactggtgtgcctggattcccaggtctaaaaggagaa
cagggtgagaagggagagcctggagccatcttgactggggatatccctctggaaatggtg
aaggggagaaagggtgaacctggagttcatggagcaccaggacctatgggacccaaagga
ccaccgggacacaaaggagaatttggcctcccaggacgacctggtcgcccaggattgaat
ggcctcaagggtgccaaaggagaccgcgggatcatgttgcctggtccacctggcctacct
ggacccccagggcccccaggaccccctggagctgtggttaacatcaaaggtgctgttttt
ccaatacctgcccggccgcactgcaaaacaccagttggtaccgctcaccctggtgaccca
gagcttgtcactttccacggtgttaaaggagagaaagggtcctggggtcttcctggcaca
aaaggagaaaagggggaccaaggagctcaaggaccaccaggccctccagtggaccccgct
tacctgagacattttctcaacagcctgaagggggagaatggagatgctgcattcagagga
gagtccagccacaacctctttgtatcagggcctccaggcctaccaggacacccaggcctg
gctgggcagaaaggagaggctgttgtggggcctcaaggacccccaggaattccaggcctg
cctgggccacctggctttgggagacctggtgttcctggaccaccgggaccccctgggcca
ccaggacctccggccattctgggtgcagctgtgccccttcccggcccacctggccctcca
ggacagccaggactccccggatccagaaacttggtcacagcgctcagtgacatgggtgac
atgctacagaaagctcacttggtcatagaagggacgttcatctacctgagggaaagtggg
gagtttttccttcgtgtccgagatggttggaaaaagttgcagttgggagaactgatcccc
attcctgctgacagccccccaccaccagcactttccagcaatccgtaccagccacagcct
ccactgaaccccattttaagtgccaattacgagagacctgttctgcacctggttgctctc
aacacgccggtggctggggacatccgagcagatttccagtgtttccagcaggccagggct
gcaggactactgtccaccttccgagcgtttctgtcatcacacttgcaggatctctccaca
gttgtgcggaaggcagagagattcagtcttccaattgtgaacctcaagggccaagtgctt
tttaacaactgggactcaatattttctggtgatggaggtcaattcaatacacacattccg
atatactcctttgatggtcgggacgtgatgactgatccttcctggccgcagaaggttgtt
tggcacggctccaacccccatggtgtccgcctcgtggacaagtactgtgaagcctggcga
accacggacatggcagtaacaggatttgcctccccactgagcacagggaagattctggac
cagaaagcatatagctgtgctaataggctaatcgttctgtgcatcgaaaacagtttcatg
acagacgcaaggaagtga

DBGET integrated database retrieval system