KEGG   Rattus norvegicus (rat): 298144
Entry
298144            CDS       T01003                                 

Gene name
Kdm4c, Jmjd2c
Definition
(RefSeq) lysine demethylase 4C
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    298144 (Kdm4c)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     298144 (Kdm4c)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     298144 (Kdm4c)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    298144 (Kdm4c)
SSDB
Motif
Pfam: JmjC zf-HC5HC2H_2 Tudor_2 zf-HC5HC2H PHD_2 JmjN LBR_tudor PHD TUDOR_5
Other DBs
NCBI-GeneID: 298144
NCBI-ProteinID: NP_001100133
RGD: 1307528
Ensembl: ENSRNOG00000006644
UniProt: B0BNJ6
Position
5q31
AA seq 1053 aa
MEVVEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKPMTVKEFRQLANSSKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRNDMVKISMDIFVKKFQPDRYQIWKQGKDIYTIDHTKPTPESTPEVKTWL
QRRKKLRKAPKSLQGNKSLSKRPKAEEDEEFAEFIGEEVSSPAVCPRHLKVTEKPEKFKL
ANIGASSEKEASDTRIQVDQSLTNDTKLSGKSCINSSVIDEIQPENDTANAVTSPSTLKK
ASDLIPFSHGHITGKESRLLKILQLESPKIPSSLAESNRVLTEGEENDEEGHASNLEPGE
VPDALSEERNGLNVPKIIEGQPKTTKSWRHPLGKPPARSPMTLVKQQVASDEELPEVLSI
DEEVEETESWAKPLIHLWQTKSPNFMAEQEYNATVAKMEPNCAICTLLMPYYKPDNSKEE
NDSRWETAVNEVVQSGRKTKPIIPEMCFIYSEENVEYSPPNAFLEEDGTSLLISCSKCFV
RVHASCYGVPSHEVCDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNQWAHVICAVAVP
EVRFTNVPERTQIDVDRIPLQRLKLKCIFCRQRVKRVSGACIQCSYGRCPASFHVTCAHA
AGVLMEPDDWPYVVNITCFRHRVNSNVKSKTCEKAISVGQTVITKHRNTRYYSCRVIDVT
SQIFYEVMFDDGSFSRDTFPEDIVSRNCVKLGPPAEGEVIQVKWPDGKLYGAKYLGSNVA
YMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADVIQGERKRQ
RVLSSRLKNEYVDDPVYRTFLKSSFQKKCQKRQ
NT seq 3162 nt   +upstreamnt  +downstreamnt
atggaggtggtggaggtggagagtcccctaaatcccagctgtaagataatgacattcaga
ccttcaatggaggagtttcgggagttcaacaaatatctcgcatacatggaatctaaagga
gcccatcgagcaggtcttgccaaggtgattcctcctaaggagtggaagccaagacaatgc
tatgatgatattgataatttgcttattccagcaccaattcagcagatggtcacaggacag
tcgggactgtttactcaatacaacatccagaaaaagcccatgactgtgaaggagttcagg
cagctggctaacagtagcaaatactgtactccaagatacttggattatgaagatttggaa
cgcaaatactggaaaaacttaacttttgtggcacctatttatggagcggatattaatggg
agcatatatgatgagggtgtggatgaatggaatatagctcgcctaaatacagtcttggat
gtggttgaagaagagtgcggcatttctattgagggtgtaaataccccttatctctatttt
ggaatgtggaaaacgacgttcgcatggcacactgaggatatggatctctacagtattaat
tatctccactttggggagcccaagtcttggtatgctatacctccagagcatggaaagcga
cttgaaagactagcccaaggctttttccccagcagctcccaaggctgtgatgcattcctc
cgccacaagatgacactgatttccccctcagtgctgaagaagtatggcattccctttgac
aagattacccaggaggctggagagttcatgattacttttccttatgggtatcatgctggt
tttaatcatggtttcaattgtgctgagtctacaaactttgctacagtcagatggattgac
tatggaaaagttgctaaattgtgcacgtgtaggaatgacatggtgaagatatcaatggat
atctttgtgaagaaatttcagccagatagataccagatttggaaacaaggaaaggatata
tatactattgaccatacaaagccaaccccagaatctaccccagaagtaaaaacatggcta
cagaggaggaaaaagttaagaaaagctcccaagagtttgcagggcaataagtcactttct
aaaaggcctaaagctgaggaagatgaggaatttgctgaattcattggggaagaggtctca
agccctgctgtgtgccctcggcacctcaaggtcacagaaaagccagaaaaattcaagctg
gcaaacataggagcatcttcagaaaaagaagcttctgatactaggatacaagtagatcaa
agcttaacgaatgacaccaagctctcaggaaaaagttgcataaattcatctgtaatagat
gaaatacaaccagagaatgacaccgccaatgctgtaacttcgccatctacgctgaagaag
gcttctgacctaataccattttctcatggccatataacaggcaaggagtcacgtttactt
aagattctccagcttgaatctcccaagataccttcttcgctggcagaaagtaatagagta
ttgacagagggagaagaaaatgatgaagagggccatgcaagtaaccttgaacctggggaa
gtcccagatgctctcagtgaagagagaaatgggctcaatgttcctaagataatagaagga
cagccaaaaactactaagagttggcgacatccacttgggaagcctccggccagatcccca
atgactcttgtaaagcagcaggtagcaagtgatgaagaattgcctgaggtcctaagcatt
gacgaagaagttgaagaaacagagtcttgggcaaagcctctgatccacctttggcagaca
aagtcgcccaactttatggctgaacaggagtacaatgcaactgtggcaaaaatggagcca
aattgtgcaatctgcactctgctcatgccatactacaagcctgataacagcaaagaagaa
aatgattctagatgggagacagcagtaaatgaagtggttcaatctggaagaaagactaaa
cccattattccagagatgtgttttatttatagtgaagaaaatgttgaatattccccccct
aatgcctttcttgaagaagatggaacaagtcttctgatttcctgttccaagtgcttcgtg
cgggttcatgcaagttgttatggtgtcccttctcatgaggtctgtgatggatggctgtgt
gcccgatgcaaaagaaatgcatggactgcagaatgctgtctctgcaatttgagaggaggt
gcacttaaacagactaagaacaatcagtgggctcatgtcatatgtgctgttgcagttcca
gaagttcgattcactaatgtcccagaaaggacacaaatagatgtagacagaataccttta
cagaggttaaaattgaaatgcatattctgtagacagcgggttaaaagggtttctggagcc
tgcatccagtgttcctatggccgctgcccagcctctttccatgttacatgtgcccatgct
gctggagtactcatggagcctgatgactggccttatgtggtaaacatcacttgcttccga
catagagtcaattcaaacgtgaagtccaaaacttgtgagaaagccatttctgtgggtcag
acagtcatcacaaaacatcgaaatactcggtactacagctgcagagtgatagatgtgaca
tctcaaatcttctatgaggtcatgtttgatgatggttccttcagcagagacacatttcct
gaggatattgtgagccgaaactgtgtgaagctgggccctcctgcagaaggagaagtcatc
caagtcaaatggcctgatggtaaactctatggagcaaagtatcttggatcaaatgttgcg
tacatgtatcaggttgaatttgaagatggatcccagatagcaatgaagagagaagacata
tacaccttagatgaagagttacccaagagagtaaaggctcgtttttccacagcctccgat
atgcgatttgaagacacattttatggagcagatgtaatccaaggggagaggaagaggcaa
agagtgctgagctccaggctcaagaatgagtatgtggatgatcctgtgtatcgtactttc
ctgaagagttctttccagaagaaatgtcagaagagacagtag

DBGET integrated database retrieval system