KEGG   Rattus norvegicus (rat): 298184
Entry
298184            CDS       T01003                                 

Gene name
Zdhhc21
Definition
(RefSeq) palmitoyltransferase ZDHHC21
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    298184 (Zdhhc21)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     298184 (Zdhhc21)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 298184
NCBI-ProteinID: NP_001034098
RGD: 1305750
Ensembl: ENSRNOG00000010484
UniProt: Q2TGI9
Position
5
AA seq 265 aa
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVIIPKIVLFPHYEEGHIPGILIIIFYGISIFC
LVALVRASLTDPGRLPENPKIPHAERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC
PWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKTRNLDLFVVRHELAIM
RLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTR
WKILWFIPFRQRQPLRVPYHFANHV
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggtcttcggattcactttgttgttgaccctcatggttggtgctgcatgggtttgatt
gtctttgtctggttatacaatattgttataattcccaaaattgtcctctttcctcactat
gaagaaggacatattcctggcattttaataataatattctatggcatttccatattttgt
ctggttgccttagtgagggcctccctaactgatcctggaagactccctgaaaatcccaag
atcccacatgcagagcgggagctgtgggagctgtgcaacaagtgtaacttgatgaggccg
aagcgctcccatcactgcagccgctgtggccactgcgtgaggaggatggaccaccactgt
ccctggataaacaactgtgtgggtgaggacaaccactggctttttctgcagttgtgcttc
tacactgagctgcttacctgctacgctctgatgttctctttctgccattattattatttc
ctgccactgaaaacacgtaatttggacctctttgttgttcggcatgagctggctatcatg
aggctggcggcctttatgggcattactatgttagtgggaatcactggactcttttataca
caactgattggaatcatcacagatacaacatctattgaaaaaatgtcaaactgttgtgaa
gaaatatcgcggccccgaaagccatggcagcagaccttctcagaagtttttggcactcgt
tggaagatcctgtggttcattcctttcaggcagaggcaaccactgagagttccctaccac
tttgccaatcacgtctaa

DBGET integrated database retrieval system